TkA04G029810 | RubberDandelionOmics

Gene overview

TkA04G029810

Reference: TK1151 Chr: Chr04 Coordinates: 7882900-7883673 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA04G029810|TK1151|cDNA

ATGGCCTTGCAAGATACTTTCCAAGCTCATTCAACCGATATCTACTTGGTCACACAGCCAAAAAGTGCTACAACGTGGATTAAGTCACTCGTCTTTGCTATTGTGAACCGAATCAAAAACCCTAAAGATGTTTTGGTCTCTTGGTTTCACTTGGCACACAAACTGAGTGACAAATCTCGTGGCCAAATGACCATTGATGAGATGTTTGAGGAAGACATGAAAATAGACACTAATAATCAAGTGAAGCGTCTGGCTGAGTT...

CDS

Download CDS FASTA

468 bp · TkA04G029810|TK1151|CDS

ATGGCCTTGCAAGATACTTTCCAAGCTCATTCAACCGATATCTACTTGGTCACACAGCCAAAAAGTGCTACAACGTGGATTAAGTCACTCGTCTTTGCTATTGTGAACCGAATCAAAAACCCTAAAGATGTTTTGGTCTCTTGGTTTCACTTGGCACACAAACTGAGTGACAAATCTCGTGGCCAAATGACCATTGATGAGATGTTTGAGGAAGACATGAAAATAGACACTAATAATCAAGTGAAGCGTCTGGCTGAGTT...

Protein

Download Protein FASTA

155 aa · TkA04G029810|TK1151|PROTEIN

MALQDTFQAHSTDIYLVTQPKSATTWIKSLVFAIVNRIKNPKDVLVSWFHLAHKLSDKSRGQMTIDEMFEEDMKIDTNNQVKRLAEFIGYTFTKEEEANGDVEEVVRLCSFEKLRMLISMDISVRVCLMKFILGNGKFEDGAIILLLKWHRFWMT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G029810`
TK1151 ID	TkA04G029810
OH-1004 ID	LXL04_036668
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.500
Protein coverage (%)	TK1151 78.710 / OH-1004 54.895 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G029810

Location Chr04:7882900-7883673 (+)

Description Similar to SOT17: Cytosolic sulfotransferase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18590`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of desulfo-glucosinolates (dsGSs), the final step in the biosynthesis of the glucosinolate core structure.	Desulfoglucosinolate sulfotransferases from Arabidopsis thaliana catalyze the final step in the biosynthesis of the glucosinolate core structure.2004 · DOI: 10.1074/jbc.m407681200 The three desulfoglucosinolate sulfotransferase proteins in Arabidopsis have different substrate specificities and are differentially expressed.2006 · DOI: 10.1111/j.1742-4658.2005.05048.x Kinetics and substrate specificities of desulfo-glucosinolate sulfotransferases in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1399-3054.2008.01182.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036668 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009812 flavonoid metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0032260 response to jasmonic acid stimulus involved in jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0051923 sulfation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0008146 sulfotransferase activity Molecular Function

GO:0047364 aromatic desulfoglucosinolate sulfotransferase activity Molecular Function

GO:0120527 aliphatic desulfoglucosinolate sulfotransferase activity Molecular Function

GO:1990135 flavonoid sulfotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18590

ath:AT1G74100

ath:AT2G03770

ath:AT5G43690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.366

Rank 1 · TkA04G029810 · TK1151

Cytoplasm0.227

Rank 2 · TkA04G029810 · TK1151

Peroxisome0.180

Rank 3 · TkA04G029810 · TK1151

Nucleus0.061

Rank 4 · TkA04G029810 · TK1151

Mitochondrion0.059

Rank 5 · TkA04G029810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22597DYN_lid3-55 aa

PF00685Sulfotransfer_112-38 aa

PF00685Sulfotransfer_139-70 aa

PF00685Sulfotransfer_169-115 aa

PF22597DYN_lid97-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G029810	`PF22597`	DYN_lid	3	55	0.081	14.0
TkA04G029810	`PF00685`	Sulfotransfer_1	12	38	2e-14	54.4
TkA04G029810	`PF00685`	Sulfotransfer_1	39	70	2e-14	54.4
TkA04G029810	`PF00685`	Sulfotransfer_1	69	115	2e-14	54.4
TkA04G029810	`PF22597`	DYN_lid	97	116	0.081	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ80`	Arabidopsis thaliana	sp\|Q9FZ80\|SOT17_ARATH Cytosolic sulfotransferase 17	26.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card