TkA04G029730 | RubberDandelionOmics

Gene overview

TkA04G029730

Reference: TK1151 Chr: Chr04 Coordinates: 7859497-7861972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkA04G029730|TK1151|cDNA

AAAAAAAAAAAAACAATTGGGAAGCTAAGGATGCGAGGATCATGTGAAGTGTGATCGAATTCGAAGGTCCCGGTAATCGCAATAACACTCCCGTATATATCTCCGGCTCCAAAACAATGGGCGACCCACCCCCATCTCTCTGTCAAGCCCCAGACCTTTGTCCGCCATTGGTCACCGATTCAGTTTCCTGAGCTTTGAAACGGCGTACACGGAAGAATCATGTCGGGTTCGAATTATACTTCTCAAGGTTTGAATATAAT...

CDS

Download CDS FASTA

813 bp · TkA04G029730|TK1151|CDS

ATGTCGGGTTCGAATTATACTTCTCAAGGTTTGAATATAATCGACGATTATGCTAGTTTAAGTACCGAAATTCGATGGTTGATATCAGCTTTTGGAGGCATCATCATGTGTAAAGTTGCATATGAATTCACGGGAATAGTTACTTCCTTTCTCCTAAATGGATTTATCAACCTCACCAAGGCACAACAACTTGAATGGAAAAACCGGGGTTTTTCTACTTTCCATGCAATTTTTGTGGCTAGTGCTTCTCTATACCTATT...

Protein

Download Protein FASTA

270 aa · TkA04G029730|TK1151|PROTEIN

MSGSNYTSQGLNIIDDYASLSTEIRWLISAFGGIIMCKVAYEFTGIVTSFLLNGFINLTKAQQLEWKNRGFSTFHAIFVASASLYLLLVSDLFYENSNEESFIKRRSTLSDTILGMSSGYFLSDMAMIIWTYPTLGGFEYILHHGLSMYAIMQSVLTGEAEFYIFMVLFTESTTPFVNLRWHLDVAGMKSSKLYLLNGIAMFLGWLVARIVLFGFFFHHIYNHIDEVRQVKTAAFCSLLTIPPVLAVMNLFWFFKIAKGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G029730`
TK1151 ID	TkA04G029730
OH-1004 ID	LXL04_000747
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.100
Protein coverage (%)	TK1151 95.926 / OH-1004 95.926 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G029730`
Location	Chr04:7859497-7861972 (+)
Description	Similar to tlcd4-b: TLC domain-containing protein 4-B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000747` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0055088 lipid homeostasis Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	dre:449652 hsa:148534 mmu:99887 xla:379606 xtr:394789 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.883

Rank 1 · TkA04G029730 · TK1151

Cytoplasm0.059

Rank 2 · TkA04G029730 · TK1151

Nucleus0.057

Rank 3 · TkA04G029730 · TK1151

Mitochondrion0.044

Rank 4 · TkA04G029730 · TK1151

Cell membrane0.042

Rank 5 · TkA04G029730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01956EMC3_TMCO126-54 aa

PF03798TRAM_LAG1_CLN865-258 aa

PF01956EMC3_TMCO196-145 aa

PF01956EMC3_TMCO1241-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G029730	`PF01956`	EMC3_TMCO1	26	54	0.72	10.3
TkA04G029730	`PF03798`	TRAM_LAG1_CLN8	65	258	3.5e-31	109.4
TkA04G029730	`PF01956`	EMC3_TMCO1	96	145	0.72	10.3
TkA04G029730	`PF01956`	EMC3_TMCO1	241	254	0.72	10.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card