TkA04G028910 | RubberDandelionOmics

Gene overview

TkA04G028910

Reference: TK1151 Chr: Chr04 Coordinates: 7629388-7631928 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · TkA04G028910|TK1151|cDNA

AAAAATTATTACTTCAATCGAAATTGCAGAGATAATCGTTACGATGGAGAGGTGGGTTCCGACGGTGTTCCTTAAATCACCAATTCTAACCCTCCTGTTAACGCCTTATCTGTCCCAAGTGAACAGTCGAAGATGGCAGAGGACGGCGCCTGGGCGGCGGAGGACGGCCCCGAATATAGCGGAGGAAGGCAGTAACGTTGGAGTTCAGGTGAAGGAGGAACGAAGTTTTGTTGATGGCTCAGTGTCCAGGCGGGGGAATT...

CDS

Download CDS FASTA

1020 bp · TkA04G028910|TK1151|CDS

ATGGAGTCTCTCTCTATAGGTCTCCCAGCTTCCCGACCATCTCTGAAGAACCCTAAATTTCACAAATTTAAAACACCCAATCCCATTTTCCTTTTCACCAGTTGCAATTTAACCCCCAATTCCATCCGATTCCGTTCTCATTTCACCAAGAAAAAACCCAAATCAACCAAATTAAGCCTCAAATCCCAGTCTCCGACTTTCCTTTTTGTGGGATTACAGTTTCCACTTTCTTCACTTGCTTCTGAAGAAATCCCCATTGA...

Protein

Download Protein FASTA

339 aa · TkA04G028910|TK1151|PROTEIN

MESLSIGLPASRPSLKNPKFHKFKTPNPIFLFTSCNLTPNSIRFRSHFTKKKPKSTKLSLKSQSPTFLFVGLQFPLSSLASEEIPIDPSSSRINLESILVSIDDFFNRYPFFVAGVAFIWLFVIPATQEYLRKYKEISALDAFKKLKEDPNAQLLDIRDNKTLRVLDSPNLKIFSKNAVQVEYRDGDDDAFSKKVKENFADPANTTICILDNFDGNSMKVAELLFNNGFKEAYAIRGGVRGNNGWLEIQETFLPPSVHIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G028910`
TK1151 ID	TkA04G028910
OH-1004 ID	LXL04_036693
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G028910

Location Chr04:7629388-7631928 (-)

Description Similar to STR4A: Rhodanese-like domain-containing protein 4A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25480`	Rhodanese-like domain-containing protein 4A, chloroplastic.	No verified direct reference in this release
`At4g01050`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	Tethering of ferredoxin:NADP+ oxidoreductase to thylakoid membranes is mediated by novel chloroplast protein TROL.2009 · DOI: 10.1111/j.1365-313x.2009.03999.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X345`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release
`Os02g0257300`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036693 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component

KEGG gene cross-reference

ath:AT3G25480

ath:AT4G01050

dosa:Os02g0257300

osa:4328925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · TkA04G028910 · TK1151

Mitochondrion0.027

Rank 2 · TkA04G028910 · TK1151

Nucleus0.022

Rank 3 · TkA04G028910 · TK1151

Cytoplasm0.016

Rank 4 · TkA04G028910 · TK1151

Cell membrane0.012

Rank 5 · TkA04G028910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28687STR4A_N97-132 aa

PF17482Phage_sheath_1C101-161 aa

PF30980STR4_M137-255 aa

PF00581Rhodanese141-240 aa

PF00581Rhodanese253-270 aa

PF17482Phage_sheath_1C260-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G028910	`PF28687`	STR4A_N	97	132	3.3e-23	81.6
TkA04G028910	`PF17482`	Phage_sheath_1C	101	161	0.13	13.1
TkA04G028910	`PF30980`	STR4_M	137	255	1.6e-38	132.0
TkA04G028910	`PF00581`	Rhodanese	141	240	1.8e-05	25.8
TkA04G028910	`PF00581`	Rhodanese	253	270	1.8e-05	25.8
TkA04G028910	`PF17482`	Phage_sheath_1C	260	308	0.13	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XR7`	Arabidopsis thaliana	sp\|Q56XR7\|STR4A_ARATH Rhodanese-like domain-containing protein 4A, chloroplastic	60.200%	Swiss-Prot	Medium
`Q9M158`	Arabidopsis thaliana	sp\|Q9M158\|STR4_ARATH Rhodanese-like domain-containing protein 4, chloroplastic	40.600%	Swiss-Prot	Low
`A2X345`	Oryza sativa subsp. indica	sp\|A2X345\|TROL_ORYSI Protein THYLAKOID RHODANESE-LIKE, chloroplastic	45.200%	Swiss-Prot	Low
`Q6ETQ7`	Oryza sativa subsp. japonica	sp\|Q6ETQ7\|TROL_ORYSJ Protein THYLAKOID RHODANESE-LIKE, chloroplastic	45.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card