TkA04G026890 | RubberDandelionOmics

Gene overview

TkA04G026890

Reference: TK1151 Chr: Chr04 Coordinates: 7073104-7074440 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · TkA04G026890|TK1151|cDNA

ATGTGCACTTGGACACGCTTGAGATTGGACGAAATAGTCAAACTTGATTTGGTGGTTGAAATTGCAGGGCAGAAGTTGCACAGTAATTTGTCAAGATTTGTAGTAACTGTGTGGTTGTTTGTAGTGTTGGTGCTTGCTTTAAGCTACACTGCAGCATTGTGTTCACTTTTAACCATTGAACAAATTCGGTTAGCGTCAAAGGGAGACTCAATTGGATACCAAGATGGTTCCTTTGTGAAGGGATATATTATTAGGAACTT...

CDS

Download CDS FASTA

774 bp · TkA04G026890|TK1151|CDS

ATGTGCACTTGGACACGCTTGAGATTGGACGAAATAGTCAAACTTGATTTGGTGGTTGAAATTGCAGGGCAGAAGTTGCACAGTAATTTGTCAAGATTTGTAGTAACTGTGTGGTTGTTTGTAGTGTTGGTGCTTGCTTTAAGCTACACTGCAGCATTGTGTTCACTTTTAACCATTGAACAAATTCGGTTAGCGTCAAAGGGAGACTCAATTGGATACCAAGATGGTTCCTTTGTGAAGGGATATATTATTAGGAACTT...

Protein

Download Protein FASTA

257 aa · TkA04G026890|TK1151|PROTEIN

MCTWTRLRLDEIVKLDLVVEIAGQKLHSNLSRFVVTVWLFVVLVLALSYTAALCSLLTIEQIRLASKGDSIGYQDGSFVKGYIIRNLNFKDTSLRPYSTSKQYADALSRGGKNGGVDAIVDEIPYLKEFLARYPSGYSMVVSERTTSGFGFAFPRGSPLVPTLSREISRLREDGTLKMLEDKWFKSDPRSMDSEPALKILDLKGCRGLFFISGVSMAVALFIFSLYFIQEKVNFTYTMLAGGKLAFILRILNLTTGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G026890`
TK1151 ID	TkA04G026890
OH-1004 ID	LXL04_036738
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.600
Protein coverage (%)	TK1151 94.553 / OH-1004 45.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G026890

Location Chr04:7073104-7074440 (+)

Description Similar to GLR1.4: Glutamate receptor 1.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07520`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
`At5g48400`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At1g42540`	Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in roots and hypocotyls (Probable).	Calcium entry mediated by GLR3.3, an Arabidopsis glutamate receptor with a broad agonist profile.2006 · DOI: 10.1104/pp.106.088989 Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134 Glutamate receptor-like channel3.3 is involved in mediating glutathione-triggered cytosolic calcium transients, transcriptional changes, and innate immunity responses in Arabidopsis.2013 · DOI: 10.1104/pp.113.217208 Involvement of the glutamate receptor AtGLR3.3 in plant defense signaling and resistance to Hyaloperonospora arabidopsidis.2013 · DOI: 10.1111/tpj.12311 GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478 Real-time, in vivo intracellular recordings of caterpillar-induced depolarization waves in sieve elements using aphid electrodes.2014 · DOI: 10.1111/nph.12807
`At2g29110`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g29100`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036738 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009630 gravitropism Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

KEGG gene cross-reference

ath:AT1G05200

ath:AT1G42540

ath:AT3G07520

ath:AT5G48400

ath:AT5G48410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.699

Rank 1 · TkA04G026890 · TK1151

Lysosome / Vacuole0.118

Rank 2 · TkA04G026890 · TK1151

Endoplasmic reticulum0.096

Rank 3 · TkA04G026890 · TK1151

Cytoplasm0.084

Rank 4 · TkA04G026890 · TK1151

Golgi apparatus0.049

Rank 5 · TkA04G026890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00060Lig_chan24-215 aa

PF00497SBP_bac_3129-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G026890	`PF00060`	Lig_chan	24	215	1e-10	42.4
TkA04G026890	`PF00497`	SBP_bac_3	129	185	0.0054	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGN1`	Arabidopsis thaliana	sp\|Q8LGN1\|GLR14_ARATH Glutamate receptor 1.4	40.400%	Swiss-Prot	Medium
`Q9LV72`	Arabidopsis thaliana	sp\|Q9LV72\|GLR12_ARATH Glutamate receptor 1.2	42.700%	Swiss-Prot	Medium
`Q9C8E7`	Arabidopsis thaliana	sp\|Q9C8E7\|GLR33_ARATH Glutamate receptor 3.3	44.500%	Swiss-Prot	Medium
`Q9C5V5`	Arabidopsis thaliana	sp\|Q9C5V5\|GLR28_ARATH Glutamate receptor 2.8	39.900%	Swiss-Prot	Medium
`O81078`	Arabidopsis thaliana	sp\|O81078\|GLR29_ARATH Glutamate receptor 2.9	41.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card