TkA04G026350 | RubberDandelionOmics

Gene overview

TkA04G026350

Reference: TK1151 Chr: Chr04 Coordinates: 6907985-6908572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA04G026350|TK1151|cDNA

GAATGCATATTCCACTGTTCATGGCTCCACAAACATAACATATCAGACGATCAAATCACAGAACTAGCTTTAGGGCTAGAGCTCACAAACGTTCCTTTCTTCCTGGTTTTGAATATTCCGGCGAGCGTTGACAGCTCCGAAGAACTGAAACGAAAGCTACCTATAGGGTTTACCGAGAGAGTGAAGGGTAAAGGAGTGGTGCATTCAGGGTGGGTCCAACAACGACACATTCTGGCTCACGAAAGCATCGGGTGTTACGT...

CDS

Download CDS FASTA

588 bp · TkA04G026350|TK1151|CDS

GAATGCATATTCCACTGTTCATGGCTCCACAAACATAACATATCAGACGATCAAATCACAGAACTAGCTTTAGGGCTAGAGCTCACAAACGTTCCTTTCTTCCTGGTTTTGAATATTCCGGCGAGCGTTGACAGCTCCGAAGAACTGAAACGAAAGCTACCTATAGGGTTTACCGAGAGAGTGAAGGGTAAAGGAGTGGTGCATTCAGGGTGGGTCCAACAACGACACATTCTGGCTCACGAAAGCATCGGGTGTTACGT...

Protein

Download Protein FASTA

195 aa · TkA04G026350|TK1151|PROTEIN

ECIFHCSWLHKHNISDDQITELALGLELTNVPFFLVLNIPASVDSSEELKRKLPIGFTERVKGKGVVHSGWVQQRHILAHESIGCYVCHAGFSSLIEALVNDCQLVMMPLKGDQVMNSRLMALDWRVGVEVNRREEDEYFGKDDVFEAVTSVMMEIDKEPAKSIRGNHEKWKGFLKNDEIQNGYISDLVENLKAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G026350`
TK1151 ID	TkA04G026350
OH-1004 ID	LXL04_014140
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.600
Protein coverage (%)	TK1151 98.974 / OH-1004 41.176 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G026350`
Location	Chr04:6907985-6908572 (+)
Description	Similar to F3GGT1: Cyanidin 3-O-galactoside 2''-O-xylosyltransferase FGGT1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014140` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0043473 pigmentation Biological Process GO:0016758 hexosyltransferase activity Molecular Function GO:0033838 flavonol-3-O-glucoside glucosyltransferase activity Molecular Function GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0035252 UDP-xylosyltransferase activity Molecular Function GO:0102455 anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:BAD95881 ag:BAD95882 gmx:100787444 ini:109188143 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.469

Rank 1 · TkA04G026350 · TK1151

Endoplasmic reticulum0.174

Rank 2 · TkA04G026350 · TK1151

Nucleus0.150

Rank 3 · TkA04G026350 · TK1151

Peroxisome0.122

Rank 4 · TkA04G026350 · TK1151

Plastid0.083

Rank 5 · TkA04G026350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11212DUF29998-33 aa

PF00201UDPGT70-154 aa

PF04013Methyltrn_RNA_273-118 aa

PF04101Glyco_tran_28_C86-122 aa

PF11212DUF2999148-160 aa

PF11212DUF2999175-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G026350	`PF11212`	DUF2999	8	33	0.1	13.5
TkA04G026350	`PF00201`	UDPGT	70	154	1e-11	45.1
TkA04G026350	`PF04013`	Methyltrn_RNA_2	73	118	0.14	12.6
TkA04G026350	`PF04101`	Glyco_tran_28_C	86	122	0.14	12.9
TkA04G026350	`PF11212`	DUF2999	148	160	0.1	13.5
TkA04G026350	`PF11212`	DUF2999	175	192	0.1	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card