TkA04G026230 | RubberDandelionOmics

Gene overview

TkA04G026230

Reference: TK1151 Chr: Chr04 Coordinates: 6876871-6879081 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1722 bp · TkA04G026230|TK1151|cDNA

AAAGAAGTAGAAAAGGTCAAAGTAGTTTTTACGCAGTTGAAAATCAATTCCACACTCCCAAATACGCCACCTCCCCCACCCTCTACCTCCTCGGCGAAGGAATTGTAGCCCTTATCAATTGAATTTCACCCACCGTCATTTCAAATTTCCACCAATAATGGGCGGCGATACAATTTCTCATCCGGATTCCTCCATTGACGACGAACACCTATCCATCAACCAGCAATTCCTTGATCGTTTAAGCGAAATTGCCACTCCAA...

CDS

Download CDS FASTA

1395 bp · TkA04G026230|TK1151|CDS

ATGGGCGGCGATACAATTTCTCATCCGGATTCCTCCATTGACGACGAACACCTATCCATCAACCAGCAATTCCTTGATCGTTTAAGCGAAATTGCCACTCCAAGGCGAGGTGGTTTGAGTGCCAAAACAACGGAAGAGAACGAATCCGTGTACACAGAATCAAACGCTAGGAGCTTCCGAGATTCTTATAACACCTCGGAGATCAAAGCGAATGAATTAAGAACGCACAGTGTCTACGCACAAGCTCTTAAGAATTACGA...

Protein

Download Protein FASTA

464 aa · TkA04G026230|TK1151|PROTEIN

MGGDTISHPDSSIDDEHLSINQQFLDRLSEIATPRRGGLSAKTTEENESVYTESNARSFRDSYNTSEIKANELRTHSVYAQALKNYDDLKQRALNIDAAKSKILSYTPGSWIENVGGTTMNDYNLPKTTTLLLIGLKGSGKSSLINRISKVFEDDKFAPERAQVTYNSSIGNGTSFLHEYMIPRTSTSFCLYDTPSFSNNSSENSQMIIKHWMTKGVSHNEFVKSSSSHKTSYKKRKVNFVIFVVNGLSVLKSMSTNGEH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G026230`
TK1151 ID	TkA04G026230
OH-1004 ID	LXL04_036749
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.800
Protein coverage (%)	TK1151 100.000 / OH-1004 85.664 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G026230`
Location	Chr04:6876871-6879081 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036749` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.218

Rank 1 · TkA04G026230 · TK1151

Cytoplasm0.204

Rank 2 · TkA04G026230 · TK1151

Cell membrane0.200

Rank 3 · TkA04G026230 · TK1151

Endoplasmic reticulum0.197

Rank 4 · TkA04G026230 · TK1151

Golgi apparatus0.135

Rank 5 · TkA04G026230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25201nSTAND676-100 aa

PF12775AAA_7119-189 aa

PF00005ABC_tran123-154 aa

PF25201nSTAND6125-153 aa

PF13555AAA_29127-153 aa

PF03193RsgA_GTPase128-199 aa

PF05673DUF815128-154 aa

PF13191AAA_16129-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G026230	`PF25201`	nSTAND6	76	100	0.027	15.2
TkA04G026230	`PF12775`	AAA_7	119	189	0.0018	18.5
TkA04G026230	`PF00005`	ABC_tran	123	154	0.013	16.8
TkA04G026230	`PF25201`	nSTAND6	125	153	0.027	15.2
TkA04G026230	`PF13555`	AAA_29	127	153	0.006	17.0
TkA04G026230	`PF03193`	RsgA_GTPase	128	199	0.0049	17.4
TkA04G026230	`PF05673`	DUF815	128	154	0.16	11.8
TkA04G026230	`PF13191`	AAA_16	129	155	0.051	14.8
TkA04G026230	`PF00735`	Septin	129	246	0.059	13.4
TkA04G026230	`PF07728`	AAA_5	131	156	0.066	13.9
TkA04G026230	`PF01926`	MMR_HSR1	132	217	7.6e-05	23.5
TkA04G026230	`PF31050`	DUF8789	240	305	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card