TkA04G025700 | RubberDandelionOmics

Gene overview

TkA04G025700

Reference: TK1151 Chr: Chr04 Coordinates: 6719558-6721073 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA04G025700|TK1151|cDNA

CTTCCTTTCCCTCCATGTTTTTCATTCCGCTTTAAAACAGATTTCCCTCCTCTTCAAATCCCCTTTTTTAAACGAGAAAAAACCCTAGTTGAATCTGAAAATTCGATCGAGAAAACTGGAGTATATATTATAATGGGGAATGATTCGAGAATGTTGGAGATGAAGAGCGTCGGAACCGTGGATGAAAATCGGGAGGAAAACGAGCTTATGTTGGAGTTGTCGATTGGGGGTATTTTTGCGAAATCGAAGAAAACGATTCA...

CDS

Download CDS FASTA

1272 bp · TkA04G025700|TK1151|CDS

CTTCCTTTCCCTCCATGTTTTTCATTCCGCTTTAAAACAGATTTCCCTCCTCTTCAAATCCCCTTTTTTAAACGAGAAAAAACCCTAGTTGAATCTGAAAATTCGATCGAGAAAACTGGAGTATATATTATAATGGGGAATGATTCGAGAATGTTGGAGATGAAGAGCGTCGGAACCGTGGATGAAAATCGGGAGGAAAACGAGCTTATGTTGGAGTTGTCGATTGGGGGTATTTTTGCGAAATCGAAGAAAACGATTCA...

Protein

Download Protein FASTA

423 aa · TkA04G025700|TK1151|PROTEIN

LPFPPCFSFRFKTDFPPLQIPFFKREKTLVESENSIEKTGVYIIMGNDSRMLEMKSVGTVDENREENELMLELSIGGIFAKSKKTIQNVSESMENDKPEEDLNVHSKREIQALRRRELRRKREEKLKKSVGIGSCGSVSGPFVENKDWLEKQIGGQNDEVLEVGFERARKKERIGNVPENVASIPTAPITNGFLNPNGLPVYGGGGEAVAHVHEDLNTKNSSFQLTACRNFKPYQGNLNQKAIEHDLDDGVRRNSKVNSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G025700`
TK1151 ID	TkA04G025700
OH-1004 ID	LXL04_036756
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 69.267 / OH-1004 69.267 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G025700

Location Chr04:6719558-6721073 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29575`	Acts as a negative regulator of abscisic acid (ABA) response and stress responses.	No verified direct reference in this release
`At1g69260`	Acts as a negative regulator of abscisic acid (ABA) response during germination through the ubiquitin-mediated proteolysis of ABI5/DPBF1.	No verified direct reference in this release
`At1g13740`	Acts as a negative regulator of abscisic acid (ABA) response during germination through the ubiquitin-mediated proteolysis of ABI5/DPBF1.	A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.2008 · DOI: 10.1007/s11103-008-9344-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0419100`	Acts as a repressor of the jasmonate antiviral pathway toward rice stripe virus (RSV) via the negative regulation of AGO18.	Perception of viral infections and initiation of antiviral defence in rice.2025 · DOI: 10.1038/s41586-025-08706-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036756 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA04G025700 · TK1151

Cytoplasm0.088

Rank 2 · TkA04G025700 · TK1151

Cell membrane0.030

Rank 3 · TkA04G025700 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA04G025700 · TK1151

Plastid0.013

Rank 5 · TkA04G025700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07897EAR24-33 aa

PF07897EAR64-84 aa

PF16135TDBD384-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G025700	`PF07897`	EAR	24	33	0.0042	17.4
TkA04G025700	`PF07897`	EAR	64	84	0.0042	17.4
TkA04G025700	`PF16135`	TDBD	384	416	1.6e-07	31.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F39`	Arabidopsis thaliana	sp\|Q94F39\|AFP3_ARATH Ninja-family protein AFP3	63.400%	Swiss-Prot	Low
`Q9LQ98`	Arabidopsis thaliana	sp\|Q9LQ98\|AFP1_ARATH Ninja-family protein AFP1	50.600%	Swiss-Prot	Low
`Q9LMX5`	Arabidopsis thaliana	sp\|Q9LMX5\|AFP2_ARATH Ninja-family protein AFP2	46.200%	Swiss-Prot	Low
`Q10JI3`	Oryza sativa subsp. japonica	sp\|Q10JI3\|NNJA3_ORYSJ Ninja-family protein 3	57.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card