TkA04G025030 | RubberDandelionOmics

Gene overview

TkA04G025030

Reference: TK1151 Chr: Chr04 Coordinates: 6525871-6528231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · TkA04G025030|TK1151|cDNA

ATATCTTGTAGAAAATGCAAAATGAATACCAGTTATGGCTTATATATGCCCATTCGTATATAATACCTATACACAAGCTGATTAAATTGTCGGAGGTCTTTGAAAAATATACGTACACACAAACAAAATGGGCCTTCATCTATGGAAGATAACGAAGATAATTGTGGCTTTATTTGAAGTAATTTTCTTTCTTAGAATTAGTGATGCAGCAAAGAATGCAAGTTTTGATGAGAATTATAAAATTACTTGGGGAAATCAAC...

CDS

Download CDS FASTA

876 bp · TkA04G025030|TK1151|CDS

ATGGGCCTTCATCTATGGAAGATAACGAAGATAATTGTGGCTTTATTTGAAGTAATTTTCTTTCTTAGAATTAGTGATGCAGCAAAGAATGCAAGTTTTGATGAGAATTATAAAATTACTTGGGGAAATCAACACGTTCAACTTCTTAATCAAGGACGAGAGGTTCAGTTGACATTGGACAAATCCTCAGGTGCTGGATTTGCTTCCAAAGCATTTTTTGCATCAGGATTCTTTCAAATGAAAATTAAACTACCCGCTAA...

Protein

Download Protein FASTA

291 aa · TkA04G025030|TK1151|PROTEIN

MGLHLWKITKIIVALFEVIFFLRISDAAKNASFDENYKITWGNQHVQLLNQGREVQLTLDKSSGAGFASKAFFASGFFQMKIKLPAKDSGGLVTAFYLFLNTTIHDEVDFEFLGNRPGKPVTLQTNVFTKGLGGREQKFNLWFDPGADFHYYKLLWNQRQLVFFVDDTPIRVYKNNIDKGIGYPNNTMQVIVSLWDGSDWATDGGKTKANFSNAPFRANFQDFNIDGCPASMPKGPKKDCFAPSFWWNTKKNWQLNPQQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G025030`
TK1151 ID	TkA04G025030
OH-1004 ID	LXL04_036774
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 52.151 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G025030

Location Chr04:6525871-6528231 (+)

Description Similar to XTH2: Xyloglucan endotransglucosylase/hydrolase protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13090`	May catalyze xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g13080`	May catalyze xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At3g25050`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At5g13870`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036774 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0030243 cellulose metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function

GO:0030247 polysaccharide binding Molecular Function

KEGG gene cross-reference

ath:AT3G25050

ath:AT4G13080

ath:AT4G13090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.391

Rank 1 · TkA04G025030 · TK1151

Lysosome / Vacuole0.196

Rank 2 · TkA04G025030 · TK1151

Golgi apparatus0.175

Rank 3 · TkA04G025030 · TK1151

Cytoplasm0.117

Rank 4 · TkA04G025030 · TK1151

Endoplasmic reticulum0.112

Rank 5 · TkA04G025030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722Glyco_hydro_1634-212 aa

PF06955XET_C244-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G025030	`PF00722`	Glyco_hydro_16	34	212	1.7e-57	194.5
TkA04G025030	`PF06955`	XET_C	244	289	1.8e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV60`	Arabidopsis thaliana	sp\|Q9SV60\|XTH2_ARATH Xyloglucan endotransglucosylase/hydrolase protein 2	55.300%	Swiss-Prot	High
`Q9SV61`	Arabidopsis thaliana	sp\|Q9SV61\|XTH1_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 1	56.800%	Swiss-Prot	High
`Q9LJR7`	Arabidopsis thaliana	sp\|Q9LJR7\|XTH3_ARATH Xyloglucan endotransglucosylase/hydrolase protein 3	52.100%	Swiss-Prot	High
`Q9XIW1`	Arabidopsis thaliana	sp\|Q9XIW1\|XTH5_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 5	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card