TkA04G024910 | RubberDandelionOmics

Gene overview

TkA04G024910

Reference: TK1151 Chr: Chr04 Coordinates: 6477409-6479463 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1970 bp · TkA04G024910|TK1151|cDNA

CTTATATCCATAATTATTGTGACTAAAATGATAACTAAGGTGGTTATTACTTGTATTTTACACAAGATAATATTACTGAAAATTTACAAAATTTTGTTAAGGACTATAAGTGACAGTTTTACATACATCAGGGGACTAAACTATGTAATTCACTTTCCACCCTTCTAGATAATCAACGTCTGGAAGCCCGCCATTTTTGAAAACATGAAAGCTTCCGGCAGTCAACCAGTTCTCAGTTTGCACAAAATGAAACATTTCTA...

CDS

Download CDS FASTA

1311 bp · TkA04G024910|TK1151|CDS

ATGGCAATGAATCAAGTGGTGGTGATGCCGTACCCAGCTAGAGGCCACCTAAATCCTCTAATGAGCCTCTGTGACTTGCTTTCTTCGAGATCAGACAGCACCACCATCTTCACCGTCGTGGTCACGGAGGAGTGGCTAGGACTCATCGGATCTGATCCAAAGCCTGATAATGTCCGATTCGCCACCATCCCTAACGTAATTCCGTCAGAGCATGGTCGCGGCTCTGACATGGTCGGATTCTTCACCGCTGTTCAAACCAA...

Protein

Download Protein FASTA

436 aa · TkA04G024910|TK1151|PROTEIN

MAMNQVVVMPYPARGHLNPLMSLCDLLSSRSDSTTIFTVVVTEEWLGLIGSDPKPDNVRFATIPNVIPSEHGRGSDMVGFFTAVQTKIEAPFEQVLDRLDLPVKLIIGDAFLSWVLDVGERRNIPVAAYWAMSASMFTMWYHVDLLEQHRHIFVDLSERGEELIDYIPGLSPTKVADLSPVTREQLRLSPNLTSTMNRAQSLILPTIYELEHEAVDALRSKSPSPIYTFGPNIRHHRSLQSHESKYMTWLDSKPPNSVLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G024910`
TK1151 ID	TkA04G024910
OH-1004 ID	LXL04_036777
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G024910

Location Chr04:6477409-6479463 (+)

Description Similar to UGT87A2: UDP-glycosyltransferase 87A2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30140`	UDP-glycosyltransferase 87A2.	No verified direct reference in this release
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release
`At1g22340`	UDP-glycosyltransferase 85A7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036777 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22340

ath:AT1G22400

ath:AT2G30140

ath:AT2G30150

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.801

Rank 1 · TkA04G024910 · TK1151

Nucleus0.238

Rank 2 · TkA04G024910 · TK1151

Peroxisome0.063

Rank 3 · TkA04G024910 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkA04G024910 · TK1151

Plastid0.049

Rank 5 · TkA04G024910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N6-31 aa

PF26168Glyco_transf_N74-143 aa

PF00201UDPGT242-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G024910	`PF26168`	Glyco_transf_N	6	31	1.1e-06	29.5
TkA04G024910	`PF26168`	Glyco_transf_N	74	143	1.1e-06	29.5
TkA04G024910	`PF00201`	UDPGT	242	365	9.4e-25	88.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64733`	Arabidopsis thaliana	sp\|O64733\|U87A2_ARATH UDP-glycosyltransferase 87A2	47.400%	Swiss-Prot	Medium
`O64732`	Arabidopsis thaliana	sp\|O64732\|U87A1_ARATH UDP-glycosyltransferase 87A1	45.700%	Swiss-Prot	Medium
`Q9SK82`	Arabidopsis thaliana	sp\|Q9SK82\|U85A1_ARATH UDP-glycosyltransferase 85A1	31.300%	Swiss-Prot	Medium
`Q9SJL0`	Arabidopsis thaliana	sp\|Q9SJL0\|U86A1_ARATH UDP-glycosyltransferase 86A1	28.600%	Swiss-Prot	Low
`Q9LME8`	Arabidopsis thaliana	sp\|Q9LME8\|U85A7_ARATH UDP-glycosyltransferase 85A7	30.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card