TkA04G023890 | RubberDandelionOmics

Gene overview

TkA04G023890

Reference: TK1151 Chr: Chr04 Coordinates: 6163034-6167110 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2441 bp · TkA04G023890|TK1151|cDNA

CTGGTTTTATTTTCATTTATTTTCTCTCTCACCGGCGAGTGGGTGTGTGCGTGTAACCGGAAGTGATTAGTGATCTGAGTAACGACAGAATCGAAGGTGAAATCGGCGAATCTCAGGCTGTTTTATGACCGGAATGTCAGACTACGGCGATCATTTAGCGAGTGCTTCACTATAAGGCATCAAAATGAGCCGGATTCAGAATGGAAAAAACCGAAACCCTGAGAAACCTATTTCAGGATGTTTGGGAAGAATGGTGACCA...

CDS

Download CDS FASTA

2049 bp · TkA04G023890|TK1151|CDS

ATGAGCCGGATTCAGAATGGAAAAAACCGAAACCCTGAGAAACCTATTTCAGGATGTTTGGGAAGAATGGTGACCAATCTGTTTGATCTAAACACCACCATAGGAGGAGGTAACAACAAGCGCCTTACAGACAAACCACATCATGAAACAACACCCATTAAGACACTAATTGCACAAGAAATGTCCAAAGAAGATGACTGTAAGCAAAGTCCATCAAATTTAGTAGCCAAACTTATGGGACTCGATGCCCTCCCACCACA...

Protein

Download Protein FASTA

682 aa · TkA04G023890|TK1151|PROTEIN

MSRIQNGKNRNPEKPISGCLGRMVTNLFDLNTTIGGGNNKRLTDKPHHETTPIKTLIAQEMSKEDDCKQSPSNLVAKLMGLDALPPQHHQQPVSPPFRHHSRHSRSHSESLLELSHQSRHEITEECKDVYEIWQQHGNNNNNNYSNNNNKMALIREKFMEAKRLSTDEKLRQSKQFQDALEVLSSNKDLFLKFLQEPDSLFSQHLYNLQSLPPPPDSRRITVLRPSKLVDNQNQSQSQSQKKNKTSSDFIFSPESCKLDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G023890`
TK1151 ID	TkA04G023890
OH-1004 ID	LXL04_036804
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.827 / OH-1004 82.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G023890`
Location	Chr04:6163034-6167110 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036804` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.429

Rank 1 · TkA04G023890 · TK1151

Cytoplasm0.376

Rank 2 · TkA04G023890 · TK1151

Nucleus0.363

Rank 3 · TkA04G023890 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA04G023890 · TK1151

Plastid0.028

Rank 5 · TkA04G023890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14383VARLMGL73-88 aa

PF09687PRESAN126-181 aa

PF22038PRC2_EED_ins136-169 aa

PF12552DUF3741141-201 aa

PF14309DUF4378365-431 aa

PF09687PRESAN377-401 aa

PF12552DUF3741393-402 aa

PF14309DUF4378641-675 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G023890	`PF14383`	VARLMGL	73	88	1.8e-05	24.9
TkA04G023890	`PF09687`	PRESAN	126	181	0.26	12.5
TkA04G023890	`PF22038`	PRC2_EED_ins	136	169	0.4	11.4
TkA04G023890	`PF12552`	DUF3741	141	201	8.5e-27	94.0
TkA04G023890	`PF14309`	DUF4378	365	431	0.00036	21.6
TkA04G023890	`PF09687`	PRESAN	377	401	0.26	12.5
TkA04G023890	`PF12552`	DUF3741	393	402	8.5e-27	94.0
TkA04G023890	`PF14309`	DUF4378	641	675	0.00036	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card