Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2549 bp · TkA04G022790|TK1151|cDNA
GCCATTTCTACAGTATGCTTGTGTGCATCTGTAACTCTCTCTCTATATATAAACAACTCGAGTCTTGTTGAATGTTAACAAGCAAAAATTTGAGTGAGCGAGAGAGAGAAAGAGAAAGATTTGTCCCCTTTGCTGCACATCATTCAGACACCGTGCCGGATTTACCTCTCTCGCTCCCTCGCTAGGGTTTCTCAATCAAAATTTCGATTCTAAAATACAATCACAGAGAGAAACCAAGGGAGATCGACTGTTAAAACCAG...
1875 bp · TkA04G022790|TK1151|CDS
ATGGATATCATGAAGACAAGTTCACACCTCGATGATCTATCTTCCTCACCTTCACCAATCCATCACAATAGCAGAAATGTCTTCCAAATGCTAGCAAGAAGAGAGATATCTCCAAGAATAAAAAAATATCTACCAAAAAAGCAAGAAAGTCAAACATCTGAACATCACCATCAGTCATTCATTAAGCCCAAAAGTGAAAGTGCAAGGGACTCAAGACGCGAGCTTCTTTCATGGGTGGAAGCCGAGTCCTTACAGTGTTT...
Protein
Download Protein FASTA624 aa · TkA04G022790|TK1151|PROTEIN
MDIMKTSSHLDDLSSSPSPIHHNSRNVFQMLARREISPRIKKYLPKKQESQTSEHHHQSFIKPKSESARDSRRELLSWVEAESLQCLSAKYCPLMPSPRSTIAAAFSSDGKYLASTHGDHTVKIIDCQTGKCLKVLSGHRRTPWVVRFHPLRPEILASGSLDHEVRLWNANTSECIGSRDFYRPIASIAFHSEGELLAVAAGHKLYLWQYNNRGETSSPSIVLRTRRSLRAVHFHPHSAQLLLTAEVNDLDSSDISMTPA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G022790 |
|---|---|
| TK1151 ID | TkA04G022790 |
| OH-1004 ID | LXL04_036816 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G022790 |
|---|---|
| Location | Chr04:5788246-5793493 (-) |
| Description | Similar to Ambra1: Activating molecule in BECN1-regulated autophagy protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000209 protein polyubiquitination Biological Process GO:0000423 mitophagy Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006914 autophagy Biological Process GO:0007281 germ cell development Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0009267 cellular response to starvation Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0030154 cell differentiation Biological Process |
| KEGG gene cross-reference | ana:alr3466 dre:100332642 dre:559106 hsa:55626 mmu:228361 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23342WDR90_beta-prop_4th95-144 aaPF24780WD40_MABP1-WDR62_1st97-216 aaPF23409Beta-prop_EML99-157 aaPF24805EIF3I99-201 aaPF11715Beta-prop_Nup120_16099-135 aaPF25174Beta-prop_THOC3103-240 aaPF23381Beta-prop_IFT122_1st103-213 aaPF00400WD40103-126 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G022790 | PF23342 | WDR90_beta-prop_4th | 95 | 144 | 0.011 | 15.6 |
| TkA04G022790 | PF24780 | WD40_MABP1-WDR62_1st | 97 | 216 | 8.6e-05 | 22.7 |
| TkA04G022790 | PF23409 | Beta-prop_EML | 99 | 157 | 8.5e-10 | 39.3 |
| TkA04G022790 | PF24805 | EIF3I | 99 | 201 | 9e-09 | 35.6 |
| TkA04G022790 | PF11715 | Beta-prop_Nup120_160 | 99 | 135 | 2.4e-05 | 23.9 |
| TkA04G022790 | PF25174 | Beta-prop_THOC3 | 103 | 240 | 1.5e-21 | 77.4 |
| TkA04G022790 | PF23381 | Beta-prop_IFT122_1st | 103 | 213 | 1.5e-19 | 71.1 |
| TkA04G022790 | PF00400 | WD40 | 103 | 126 | 4.1e-16 | 59.4 |
| TkA04G022790 | PF25173 | Beta-prop_WDR3_1st | 103 | 209 | 5.9e-13 | 49.6 |
| TkA04G022790 | PF24796 | WDR55 | 103 | 176 | 7.4e-10 | 39.1 |
| TkA04G022790 | PF25047 | Beta-prop_TEP1_2nd | 103 | 212 | 0.0001 | 22.3 |
| TkA04G022790 | PF25391 | WD40_Gbeta | 103 | 198 | 0.0024 | 17.6 |
| TkA04G022790 | PF23410 | Beta-prop_VPS8 | 103 | 140 | 0.31 | 10.7 |
| TkA04G022790 | PF25175 | Beta-prop_WDR5 | 104 | 244 | 5.4e-22 | 79.1 |
| TkA04G022790 | PF24817 | WD40_WDHD1_1st | 104 | 205 | 1.6e-14 | 54.5 |
| TkA04G022790 | PF25172 | Beta-prop_WDR3_2nd | 104 | 204 | 1.2e-07 | 31.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.