RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G021680
Reference: TK1151 Chr: Chr04 Coordinates: 5488069-5499508 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1233 bp · TkA04G021680|TK1151|cDNA

ATGCTAGGGTATGAAATGTGTGAAAGAATGGCATACTATGGAATAGCAACAAATTTGGTGTTGTACTTAACAAGGGAATTGCATGAAGGCACCGTGAAATCATCCAACAATGTCACAAATTGGGTGGGAACCGTGTGGATGACTCCTCTTTTGGGTGCATATATTGCTGACACATATCTAGGAAGATATTGGACTTTCATGATTGCTTCAGTCATTTATTTTCTGGGAATGTGCTTCTTAAGTATCGTGGTTTCACTATC...

CDS

Download CDS FASTA

1233 bp · TkA04G021680|TK1151|CDS

ATGCTAGGGTATGAAATGTGTGAAAGAATGGCATACTATGGAATAGCAACAAATTTGGTGTTGTACTTAACAAGGGAATTGCATGAAGGCACCGTGAAATCATCCAACAATGTCACAAATTGGGTGGGAACCGTGTGGATGACTCCTCTTTTGGGTGCATATATTGCTGACACATATCTAGGAAGATATTGGACTTTCATGATTGCTTCAGTCATTTATTTTCTGGGAATGTGCTTCTTAAGTATCGTGGTTTCACTATC...

Protein

Download Protein FASTA

410 aa · TkA04G021680|TK1151|PROTEIN

MLGYEMCERMAYYGIATNLVLYLTRELHEGTVKSSNNVTNWVGTVWMTPLLGAYIADTYLGRYWTFMIASVIYFLGMCFLSIVVSLSSLKPPTCGKDCDKRASSFQVGIFYCALYIIAIGTGGTKPNISTMGADQFDDFEPKEKAHKLTFFNWWMFSIFFGTLFANTFLIYIQDNVTWSLGYGIPTLALFVAIIAFIFGTPTYRHKPKGESPFTKMAKVLVATLRKRNVVVPIDPKELHELTLDEYSSPGKYRIDHSNSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G021680
TK1151 IDTkA04G021680
OH-1004 IDLXL04_036838
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)72.700
Protein coverage (%)TK1151 100.000 / OH-1004 93.761
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G021680
LocationChr04:5488069-5499508 (-)
DescriptionSimilar to NPF5.2: Protein NRT1/ PTR FAMILY 5.2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g46050 Peptide transporter involved in stress tolerance in seeds during germination and in defense against virulent bacterial pathogens.
Structural and functional characterization of AtPTR3, a stress-induced peptide transporter of Arabidopsis.2005 · DOI: 10.1007/s00894-005-0257-6
AtPTR3, a wound-induced peptide transporter needed for defence against virulent bacterial pathogens in Arabidopsis.2007 · DOI: 10.1007/s00425-006-0451-5
At5g46040 Peptide transporter. No verified direct reference in this release
At2g40460 Protein NRT1/ PTR FAMILY 5.1. No verified direct reference in this release
At3g54140 Peptide transporter.
AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x
AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
At2g02040 Peptide transporter. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036838 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009611 response to wounding Biological Process
GO:0009624 response to nematode Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0015031 protein transport Biological Process
GO:0015833 peptide transport Biological Process
GO:0042538 hyperosmotic salinity response Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0042938 dipeptide transport Biological Process
GO:0042939 tripeptide transport Biological Process
GO:0043201 response to L-leucine Biological Process
KEGG gene cross-reference
ath:AT2G02040
ath:AT2G40460
ath:AT3G54140
ath:AT5G46040
ath:AT5G46050
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.559
Rank 1 · TkA04G021680 · TK1151
Lysosome / Vacuole0.188
Rank 2 · TkA04G021680 · TK1151
Endoplasmic reticulum0.120
Rank 3 · TkA04G021680 · TK1151
Cytoplasm0.087
Rank 4 · TkA04G021680 · TK1151
Golgi apparatus0.049
Rank 5 · TkA04G021680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_17-338 aa
PF00854PTR263-243 aa
PF28301ElxI1163-203 aa
PF23688YlcJ165-177 aa
PF00854PTR2261-306 aa
PF00854PTR2306-348 aa
PF23688YlcJ325-333 aa
PF28301ElxI1358-385 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G021680PF07690MFS_173386.4e-1142.5
TkA04G021680PF00854PTR2632434.3e-60204.4
TkA04G021680PF28301ElxI11632032.19.2
TkA04G021680PF23688YlcJ1651770.1213.3
TkA04G021680PF00854PTR22613064.3e-60204.4
TkA04G021680PF00854PTR23063484.3e-60204.4
TkA04G021680PF23688YlcJ3253330.1213.3
TkA04G021680PF28301ElxI13583852.19.2
TkA04G021680PF07690MFS_13603786.4e-1142.5
TkA04G021680PF23688YlcJ3733850.1213.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FNL7Arabidopsis thalianasp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.244.500%Swiss-ProtMedium
Q9FNL8Arabidopsis thalianasp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.342.400%Swiss-ProtMedium
Q8VZR7Arabidopsis thalianasp|Q8VZR7|PTR30_ARATH Protein NRT1/ PTR FAMILY 5.139.100%Swiss-ProtMedium
Q9M390Arabidopsis thalianasp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.133.300%Swiss-ProtMedium
P46032Arabidopsis thalianasp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.333.000%Swiss-ProtMedium

JBrowse

View in Genome Browser