TkA04G021170 | RubberDandelionOmics

Gene overview

TkA04G021170

Reference: TK1151 Chr: Chr04 Coordinates: 5370930-5373480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1416 bp · TkA04G021170|TK1151|cDNA

ATAAAAAACTTACCAAGTTCTAAATATAGATGATATTACTAAACAACTGTTTCCAAATTAAAAATTAGGATTAAACCATATAATTAATAAACCTATAATTTCATGTGCTTCAAAATAAAACTTCTTGCCATTCGTTTCTTGACTTTCTTCCTCATGTCGATTTTTTCTTACTCACCATAAGAAAAAAATAGTAATGATTTCTTTGAAAACTTAAAGTAGGATTAGAAATGGAGGTTGCCTTTTTCTTTGTGACAAACCTC...

CDS

Download CDS FASTA

621 bp · TkA04G021170|TK1151|CDS

ATGTTTAATTTATATTCTTTTCTTTATATGCATTTGATAGAGGTTTCTGTTAGATGCTTGTCGCGATACAACATTGATCATTTTAATGGTAGTTGCTGCTGCTTCTTGGCACTTGGTATAAAAACAGAGGGGATAAAAGAAGGGTGGTATGATGGTGGAAGCATAGCTTTGGCTGTGATAATTGTCATAGTCGTTACAGCTATAAGTGATTACAAACAATCACTTCAATTTCAGAACCTAAACGAAGAGAAGCAGAATAT...

Protein

Download Protein FASTA

206 aa · TkA04G021170|TK1151|PROTEIN

MFNLYSFLYMHLIEVSVRCLSRYNIDHFNGSCCCFLALGIKTEGIKEGWYDGGSIALAVIIVIVVTAISDYKQSLQFQNLNEEKQNIHLEVVRGGRRIEISIFDIVVGDVIPLKIGDHVPADGVLISGHSLSIDESSMTGESKIVHKDHKNPFLMSGCKVADGYGTMLATSVGIHNNDEETPLRVRLNGVATFIGIVGLVVAVLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G021170`
TK1151 ID	TkA04G021170
OH-1004 ID	LXL04_036840
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.800
Protein coverage (%)	TK1151 81.553 / OH-1004 68.702 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G021170

Location Chr04:5370930-5373480 (+)

Description Similar to ACA8: Calcium-transporting ATPase 8, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At3g63380`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036840 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009624 response to nematode Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0055081 monoatomic anion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT3G21180

ath:AT3G57330

ath:AT4G29900

ath:AT5G57110

dosa:Os04g0605500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.306

Rank 1 · TkA04G021170 · TK1151

Golgi apparatus0.229

Rank 2 · TkA04G021170 · TK1151

Lysosome / Vacuole0.206

Rank 3 · TkA04G021170 · TK1151

Cell membrane0.187

Rank 4 · TkA04G021170 · TK1151

Cytoplasm0.185

Rank 5 · TkA04G021170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00122E1-E2_ATPase88-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G021170	`PF00122`	E1-E2_ATPase	88	174	6.7e-19	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF79`	Arabidopsis thaliana	sp\|Q9LF79\|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type	77.200%	Swiss-Prot	High
`Q9LU41`	Arabidopsis thaliana	sp\|Q9LU41\|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type	74.300%	Swiss-Prot	High
`Q9SZR1`	Arabidopsis thaliana	sp\|Q9SZR1\|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type	73.900%	Swiss-Prot	High
`Q9LY77`	Arabidopsis thaliana	sp\|Q9LY77\|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type	52.900%	Swiss-Prot	High
`Q7X8B5`	Oryza sativa subsp. japonica	sp\|Q7X8B5\|ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type	77.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card