TkA04G020640 | RubberDandelionOmics

Gene overview

TkA04G020640

Reference: TK1151 Chr: Chr04 Coordinates: 5249296-5250630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA04G020640|TK1151|cDNA

ATGGGATCAAAAGTAGAAGATGTTGACGAGTTGATGCACAATATACAATCATTTTTGCCTTTAAAAGAAGCAGCCGGCACGAGCGTGTTATCCAAGTCTTGGCTGCGCGCATGGTCTACCATCCCTACCCTCGATTTTGATGTTCGAAGAGGAAAGGAGTTGAAGTTAATGGACATTGCCCGCACTGTGATTCGGTATCTCCGTGACAACATACCAATCGAAGCGTTTACCCTTAAGATCGACATCGAGAACCAGGAGTC...

CDS

Download CDS FASTA

483 bp · TkA04G020640|TK1151|CDS

ATGGGATCAAAAGTAGAAGATGTTGACGAGTTGATGCACAATATACAATCATTTTTGCCTTTAAAAGAAGCAGCCGGCACGAGCGTGTTATCCAAGTCTTGGCTGCGCGCATGGTCTACCATCCCTACCCTCGATTTTGATGTTCGAAGAGGAAAGGAGTTGAAGTTAATGGACATTGCCCGCACTGTGATTCGGTATCTCCGTGACAACATACCAATCGAAGCGTTTACCCTTAAGATCGACATCGAGAACCAGGAGTC...

Protein

Download Protein FASTA

160 aa · TkA04G020640|TK1151|PROTEIN

MGSKVEDVDELMHNIQSFLPLKEAAGTSVLSKSWLRAWSTIPTLDFDVRRGKELKLMDIARTVIRYLRDNIPIEAFTLKIDIENQESASHVVENLIGPMASKPYLKKISLLINLWSGYSFMLPYEIWASENLTKLKVSSDIKWNHSIWMTNTPIQYVSTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G020640`
TK1151 ID	TkA04G020640
OH-1004 ID	LXL04_036851
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.800
Protein coverage (%)	TK1151 95.625 / OH-1004 15.644 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G020640

Location Chr04:5249296-5250630 (-)

Description Similar to At5g02700: Putative F-box/LRR-repeat protein At5g02700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14103`	F-box/LRR-repeat protein At4g14103.	No verified direct reference in this release
`At4g14096`	F-box/LRR-repeat protein At4g14096.	No verified direct reference in this release
`At3g59200`	F-box/LRR-repeat protein At3g59200.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036851 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G58310

ath:AT3G28410

ath:AT5G02700

ath:AT5G02920

ath:AT5G56410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.560

Rank 1 · TkA04G020640 · TK1151

Cytoplasm0.394

Rank 2 · TkA04G020640 · TK1151

Endoplasmic reticulum0.078

Rank 3 · TkA04G020640 · TK1151

Cell membrane0.075

Rank 4 · TkA04G020640 · TK1151

Extracellular0.055

Rank 5 · TkA04G020640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17889NLRC4_HD6-36 aa

PF00646F-box9-40 aa

PF17889NLRC4_HD60-71 aa

PF17889NLRC4_HD103-131 aa

PF00646F-box122-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G020640	`PF17889`	NLRC4_HD	6	36	0.19	12.8
TkA04G020640	`PF00646`	F-box	9	40	0.0082	16.8
TkA04G020640	`PF17889`	NLRC4_HD	60	71	0.19	12.8
TkA04G020640	`PF17889`	NLRC4_HD	103	131	0.19	12.8
TkA04G020640	`PF00646`	F-box	122	127	0.0082	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7H1`	Arabidopsis thaliana	sp\|Q8L7H1\|FBL75_ARATH F-box/LRR-repeat protein At4g14103	31.000%	Swiss-Prot	Medium
`Q94B46`	Arabidopsis thaliana	sp\|Q94B46\|FBL74_ARATH F-box/LRR-repeat protein At4g14096	32.300%	Swiss-Prot	Medium
`Q9LX51`	Arabidopsis thaliana	sp\|Q9LX51\|FBL64_ARATH F-box/LRR-repeat protein At3g59200	29.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card