RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G020610
Reference: TK1151 Chr: Chr04 Coordinates: 5244502-5245874 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

852 bp · TkA04G020610|TK1151|cDNA

TTACCATATAAACCCTCCCCTATCGAAAACCCTAAGTTTCATCGTCTTCATCGCTACCCGCCAGTCTTCATCGGCGATCTGCATACAGAACCGCCGAAATGCCGTTCAAGAGGTACGTTGAGATCGGGAGAATCGCACTCGTCAACTACGGAAAGGATTATGGAAGGCTTGTCGTCATCGTCGATGTCATCGATCAAAACAGGCAGGCACTTGTTGATGCTCCAGACATGGTAAGGGGTCAAATGAACTTCAAAAGACTG...

CDS

Download CDS FASTA

408 bp · TkA04G020610|TK1151|CDS

ATGCCGTTCAAGAGGTACGTTGAGATCGGGAGAATCGCACTCGTCAACTACGGAAAGGATTATGGAAGGCTTGTCGTCATCGTCGATGTCATCGATCAAAACAGGCAGGCACTTGTTGATGCTCCAGACATGGTAAGGGGTCAAATGAACTTCAAAAGACTGACTCTTACAGACATTAAGATTGACATCAATAGAGTCCCAAACAAAAAAACTCTTGTTGCTGCTTTAGAAGCTGCTGATGTTAAGAACAAGTGGGAGAA...

Protein

Download Protein FASTA

135 aa · TkA04G020610|TK1151|PROTEIN

MPFKRYVEIGRIALVNYGKDYGRLVVIVDVIDQNRQALVDAPDMVRGQMNFKRLTLTDIKIDINRVPNKKTLVAALEAADVKNKWENSSWGRKLIVQKKRASLNDFDRFKIMLAKIKKAGVVRQELAKLKKETTA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G020610
TK1151 IDTkA04G020610
OH-1004 IDLXL04_000919
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)97.000
Protein coverage (%)TK1151 98.519 / OH-1004 99.248
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G020610
LocationChr04:5244502-5245874 (+)
DescriptionSimilar to RPL14B: 60S ribosomal protein L14-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g27090 Large ribosomal subunit protein eL14y. No verified direct reference in this release
At2g20450 Large ribosomal subunit protein eL14z. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000919 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006412 translation Biological Process
GO:0042273 ribosomal large subunit biogenesis Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0022625 cytosolic large ribosomal subunit Cellular Component
GO:0022626 cytosolic ribosome Cellular Component
KEGG gene cross-reference
ath:AT2G20450
ath:AT4G27090
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.882
Rank 1 · TkA04G020610 · TK1151
Nucleus0.218
Rank 2 · TkA04G020610 · TK1151
Endoplasmic reticulum0.155
Rank 3 · TkA04G020610 · TK1151
Mitochondrion0.031
Rank 4 · TkA04G020610 · TK1151
Cell membrane0.021
Rank 5 · TkA04G020610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00467KOW10-35 aa
PF28967DUF848812-86 aa
PF28943PepS8_pro_Ba33-116 aa
PF01929Ribosomal_L14e46-118 aa
PF28967DUF8488103-122 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G020610PF00467KOW10350.008116.7
TkA04G020610PF28967DUF848812860.1114.1
TkA04G020610PF28943PepS8_pro_Ba331160.0514.3
TkA04G020610PF01929Ribosomal_L14e461184.5e-2795.1
TkA04G020610PF28967DUF84881031220.1114.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9T043Arabidopsis thalianasp|Q9T043|RL142_ARATH Large ribosomal subunit protein eL14y84.400%Swiss-ProtHigh
Q9SIM4Arabidopsis thalianasp|Q9SIM4|RL141_ARATH Large ribosomal subunit protein eL14z80.700%Swiss-ProtHigh

JBrowse

View in Genome Browser