TkA04G017520 | RubberDandelionOmics

Gene overview

TkA04G017520

Reference: TK1151 Chr: Chr04 Coordinates: 4362649-4365732 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA04G017520|TK1151|cDNA

ATGGCGAAATCGGAATGGAGCCGTGGTGGAGGACGTCGTCGCCTCGTCGGTGGTTGCCAATGGAGTCGCCGAGAACAGAAGCCCGCCTCCCCATCCCGCCTCCCGTCTCCCTCTCTCGAACCAGTCGACTGCTGCGATCATCAACCTTCTGCTGCGAGCTGCAGCTCCGAGCTGCAACCTTCAACCGGCGCACTACCCTCGCTGCGACGCTCCTCCAGCCCCGACGCCCGCTTCAGAGATTCATACGACTACAGAGAACA...

CDS

Download CDS FASTA

402 bp · TkA04G017520|TK1151|CDS

ATGGCGAAATCGGAATGGAGCCGTGGTGGAGGACGTCGTCGCCTCGTCGGTGGTTGCCAATGGAGTCGCCGAGAACAGAAGCCCGCCTCCCCATCCCGCCTCCCGTCTCCCTCTCTCGAACCAGTCGACTGCTGCGATCATCAACCTTCTGCTGCGAGCTGCAGCTCCGAGCTGCAACCTTCAACCGGCGCACTACCCTCGCTGCGACGCTCCTCCAGCCCCGACGCCCGCTTCAGAGATTCATACGACTACAGAGAACA...

Protein

Download Protein FASTA

133 aa · TkA04G017520|TK1151|PROTEIN

MAKSEWSRGGGRRRLVGGCQWSRREQKPASPSRLPSPSLEPVDCCDHQPSAASCSSELQPSTGALPSLRRSSSPDARFRDSYDYREQDLRNKSQLLIEMNPIHLKIPVLIHNGKPICESSIIVEYIDEVGKIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G017520`
TK1151 ID	TkA04G017520
OH-1004 ID	LXL04_001746
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.600
Protein coverage (%)	TK1151 39.850 / OH-1004 23.661 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G017520

Location Chr04:4362649-4365732 (-)

Description Similar to Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17170`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At1g17180`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001746 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009629 response to gravity Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0046256 2,4,6-trinitrotoluene catabolic process Biological Process

GO:2000030 regulation of response to red or far red light Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G17170

ath:AT1G17180

ath:AT1G78370

nta:107782951

nta:107823949

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.459

Rank 1 · TkA04G017520 · TK1151

Cytoplasm0.444

Rank 2 · TkA04G017520 · TK1151

Mitochondrion0.094

Rank 3 · TkA04G017520 · TK1151

Cell membrane0.088

Rank 4 · TkA04G017520 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA04G017520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08889WbqC78-121 aa

PF13417GST_N_381-128 aa

PF02798GST_N85-128 aa

PF13409GST_N_286-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G017520	`PF08889`	WbqC	78	121	0.21	12.2
TkA04G017520	`PF13417`	GST_N_3	81	128	1.9e-07	32.1
TkA04G017520	`PF02798`	GST_N	85	128	2.2e-10	41.4
TkA04G017520	`PF13409`	GST_N_2	86	128	2.4e-06	28.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHH6`	Arabidopsis thaliana	sp\|Q9SHH6\|GSTUO_ARATH Glutathione S-transferase U24	71.700%	Swiss-Prot	Low
`Q9SHH7`	Arabidopsis thaliana	sp\|Q9SHH7\|GSTUP_ARATH Glutathione S-transferase U25	71.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card