TkA04G013470 | RubberDandelionOmics

Gene overview

TkA04G013470

Reference: TK1151 Chr: Chr04 Coordinates: 3353310-3354963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1438 bp · TkA04G013470|TK1151|cDNA

TACGGATATTTTTGAACACCCCTACCACCACCTATAAATACGACCCGGATTTGTAACTCAAAAGACTTGTTGTCTCCTTCCACAAAATGGGCAGCAACTCCGTCCAACCACCACCGCAATACGCCCCCTACCGCCTCCTCAAAACCTTAACCGCCCACCAATCCGCCGTCTCCTGCGTCAAATTCTCCAACAGCGGCAAACTCCTCGCCTCCGCCTCCTTAGACAAAACCCTCATCCTCTGGAACGCCGAAAAACTAACC...

CDS

Download CDS FASTA

945 bp · TkA04G013470|TK1151|CDS

ATGGGCAGCAACTCCGTCCAACCACCACCGCAATACGCCCCCTACCGCCTCCTCAAAACCTTAACCGCCCACCAATCCGCCGTCTCCTGCGTCAAATTCTCCAACAGCGGCAAACTCCTCGCCTCCGCCTCCTTAGACAAAACCCTCATCCTCTGGAACGCCGAAAAACTAACCCTAATCTCCCGCCTCGTCGGCCACACCGAAGGCGTCTCCGACCTCGCCTGGTCCTCCGACTCCCACTACATCTGCTCCGCCTCCGA...

Protein

Download Protein FASTA

314 aa · TkA04G013470|TK1151|PROTEIN

MGSNSVQPPPQYAPYRLLKTLTAHQSAVSCVKFSNSGKLLASASLDKTLILWNAEKLTLISRLVGHTEGVSDLAWSSDSHYICSASDDKTLRIWDARANECVKTLRGHTDFVFCVNFSVHSNLIVSGSFDETIRVWDVKTGKTNHVIRAHSLPVTSVHFNRDGSLIVSGSHDGSCKIWDTATGTCLKTLIDDKVPAVSFTKFSPNGKFILVATLDDNLKLWNYSTGKFLKMYTGHVNKKYCITPTFSVTNGKYIVSGSED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G013470`
TK1151 ID	TkA04G013470
OH-1004 ID	LXL04_013656
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.200
Protein coverage (%)	TK1151 25.796 / OH-1004 24.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G013470

Location Chr04:3353310-3354963 (+)

Description Similar to WDR5A: COMPASS-like H3K4 histone methylase component WDR5A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02730`	COMPASS-like H3K4 histone methylase component WDR5B.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013656 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0018022 peptidyl-lysine methylation Biological Process

GO:0032259 methylation Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT3G49660

bta:100125836

hsa:11091

mmu:140858

rno:362093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.774

Rank 1 · TkA04G013470 · TK1151

Cytoplasm0.301

Rank 2 · TkA04G013470 · TK1151

Cell membrane0.029

Rank 3 · TkA04G013470 · TK1151

Mitochondrion0.025

Rank 4 · TkA04G013470 · TK1151

Lysosome / Vacuole0.020

Rank 5 · TkA04G013470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25178Beta-prop_WDR4113-73 aa

PF24782WD40_MABP1-WDR62_2nd15-178 aa

PF23756Beta-prop_HPS515-88 aa

PF31099SHKBP1_KCTD3_C15-43 aa

PF24814WD40_Prp1916-103 aa

PF20426NBCH_WD4016-60 aa

PF23798Beta-prop_SPT816-74 aa

PF00400WD4017-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G013470	`PF25178`	Beta-prop_WDR41	13	73	5.4e-17	62.4
TkA04G013470	`PF24782`	WD40_MABP1-WDR62_2nd	15	178	8.5e-24	84.8
TkA04G013470	`PF23756`	Beta-prop_HPS5	15	88	2.6e-09	37.5
TkA04G013470	`PF31099`	SHKBP1_KCTD3_C	15	43	0.00051	19.4
TkA04G013470	`PF24814`	WD40_Prp19	16	103	2.6e-56	191.4
TkA04G013470	`PF20426`	NBCH_WD40	16	60	1.5e-22	80.7
TkA04G013470	`PF23798`	Beta-prop_SPT8	16	74	2e-12	47.5
TkA04G013470	`PF00400`	WD40	17	53	1.6e-70	231.3
TkA04G013470	`PF23381`	Beta-prop_IFT122_1st	17	94	1.2e-68	232.1
TkA04G013470	`PF24105`	Beta-prop_CAF1B_HIR1	17	98	3e-38	132.5
TkA04G013470	`PF25047`	Beta-prop_TEP1_2nd	17	102	4.3e-35	121.8
TkA04G013470	`PF24796`	WDR55	17	179	6.8e-35	121.3
TkA04G013470	`PF25391`	WD40_Gbeta	17	116	4.3e-31	108.9
TkA04G013470	`PF25168`	Beta-prop_WDR36-Utp21_2nd	17	96	5.6e-30	105.5
TkA04G013470	`PF24807`	WD40_CDC20-Fz	18	76	2.6e-44	152.4
TkA04G013470	`PF25171`	Beta-prop_WDR36-Utp21_1st	18	94	3.2e-35	122.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY00`	Arabidopsis thaliana	sp\|Q9SY00\|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B	60.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card