TkA04G012400 | RubberDandelionOmics

Gene overview

TkA04G012400

Reference: TK1151 Chr: Chr04 Coordinates: 3102487-3103502 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

600 bp · TkA04G012400|TK1151|cDNA

AAACAAAATCATGGAAACCCAAAAGTTTTATCCCTTCTTTCTTCATGTCTTGAGAAATCGGTTAAAAAGAACGAGACATTGTTGCAGACAACGCAAACTAAAGACATTATTACAGTTTTTCATGGCTCAAGAGCTCCTACACTTACCATTCAACAATACATCAGTCGTATCTTTAAGTACTCTCGTTGTAGTCCTTCATGCTTCATTGTTGCACTTATATACATGGATAGATTCATCCAATCTGAAAATATCATTCTGAC...

CDS

Download CDS FASTA

600 bp · TkA04G012400|TK1151|CDS

AAACAAAATCATGGAAACCCAAAAGTTTTATCCCTTCTTTCTTCATGTCTTGAGAAATCGGTTAAAAAGAACGAGACATTGTTGCAGACAACGCAAACTAAAGACATTATTACAGTTTTTCATGGCTCAAGAGCTCCTACACTTACCATTCAACAATACATCAGTCGTATCTTTAAGTACTCTCGTTGTAGTCCTTCATGCTTCATTGTTGCACTTATATACATGGATAGATTCATCCAATCTGAAAATATCATTCTGAC...

Protein

Download Protein FASTA

199 aa · TkA04G012400|TK1151|PROTEIN

KQNHGNPKVLSLLSSCLEKSVKKNETLLQTTQTKDIITVFHGSRAPTLTIQQYISRIFKYSRCSPSCFIVALIYMDRFIQSENIILTSFNVHRLLITSIMLATKFIDEAFYNNAYYAKVGGVTTTELNRLEMKFLFGIDFRLYVDTCTFGRYCSVLMNATSGEEVDIEHVIHGVCGIKENWSNNADDSSCHPTIGIHIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G012400`
TK1151 ID	TkA04G012400
OH-1004 ID	LXL04_001053
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.300
Protein coverage (%)	TK1151 97.487 / OH-1004 83.260 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G012400

Location Chr04:3102487-3103502 (-)

Description Similar to CYCP3-1: Cyclin-P3-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63120`	Cyclin-U3-1.	No verified direct reference in this release
`At2g44740`	Cyclin-U4-1.	No verified direct reference in this release
`At5g07450`	Cyclin-U4-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0398000`	Cyclin-P3-1.	No verified direct reference in this release
`Os10g0563900`	Cyclin-P4-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001053 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G44740

ath:AT3G63120

ath:AT5G07450

ath:AT5G61650

dosa:Os05g0398000

osa:4338711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.566

Rank 1 · TkA04G012400 · TK1151

Cytoplasm0.444

Rank 2 · TkA04G012400 · TK1151

Mitochondrion0.074

Rank 3 · TkA04G012400 · TK1151

Cell membrane0.031

Rank 4 · TkA04G012400 · TK1151

Plastid0.021

Rank 5 · TkA04G012400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08613Cyclin23-142 aa

PF00134Cyclin_N50-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G012400	`PF08613`	Cyclin	23	142	5.6e-39	134.6
TkA04G012400	`PF00134`	Cyclin_N	50	142	9.3e-12	45.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB60`	Arabidopsis thaliana	sp\|Q8LB60\|CCU31_ARATH Cyclin-U3-1	47.900%	Swiss-Prot	Medium
`O80513`	Arabidopsis thaliana	sp\|O80513\|CCU41_ARATH Cyclin-U4-1	52.000%	Swiss-Prot	High
`Q9LY16`	Arabidopsis thaliana	sp\|Q9LY16\|CCU42_ARATH Cyclin-U4-2	47.700%	Swiss-Prot	Medium
`Q75HV0`	Oryza sativa subsp. japonica	sp\|Q75HV0\|CCP31_ORYSJ Cyclin-P3-1	53.600%	Swiss-Prot	High
`Q7XC35`	Oryza sativa subsp. japonica	sp\|Q7XC35\|CCP41_ORYSJ Cyclin-P4-1	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card