TkA04G011710 | RubberDandelionOmics

Gene overview

TkA04G011710

Reference: TK1151 Chr: Chr04 Coordinates: 2874014-2880440 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · TkA04G011710|TK1151|cDNA

CTTAACAACTTTCAAAAAGAGCGAGCAGGACTGGCCCGCTTTTCGCGGTTAGAAGTGCACCGGTTCACCGAGGTTTTAAGCCAAGTGTTGTTGTTGTTGCCTCCAATTCTCAGAAACGCAGGTCTCCTCTTTGTCTCATCTTCTTACTTCATAAACCTCGTGGCTCTCACTGAATTCGAAACAACTACACCAATGAATACATTAACCCTTGCCCTAGCCGCCGGTGCCGGACTTTCGAGGAGGTCTATAGTCACAGATTC...

CDS

Download CDS FASTA

1602 bp · TkA04G011710|TK1151|CDS

CTTAACAACTTTCAAAAAGAGCGAGCAGGACTGGCCCGCTTTTCGCGGTTAGAAGTGCACCGGTTCACCGAGGTTTTAAGCCAAGTGTTGTTGTTGTTGCCTCCAATTCTCAGAAACGCAGGTCTCCTCTTTGTCTCATCTTCTTACTTCATAAACCTCGTGGCTCTCACTGAATTCGAAACAACTACACCAATGAATACATTAACCCTTGCCCTAGCCGCCGGTGCCGGACTTTCGAGGAGGTCTATAGTCACAGATTC...

Protein

Download Protein FASTA

533 aa · TkA04G011710|TK1151|PROTEIN

LNNFQKERAGLARFSRLEVHRFTEVLSQVLLLLPPILRNAGLLFVSSSYFINLVALTEFETTTPMNTLTLALAAGAGLSRRSIVTDSNDIEFGNPWWFIYAGVSCALVLFAGIMSGLTLGLMSLGVVELEILHRSGTNKEKKQAAAILPVVQKQHQLLVTLLLCNAAAMEALPIYLDKIFHPAVAVLLSVTFVLIFGEVIPQAISTRYGLAVGANFVGLVRFLMIVCYPIAYPVGKVLDALIGHNDALFRRAQLKALVSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011710`
TK1151 ID	TkA04G011710
OH-1004 ID	LXL04_036993
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.124 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011710

Location Chr04:2874014-2880440 (-)

Description Similar to CBSDUF4: Putative DUF21 domain-containing protein At1g03270

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14240`	DUF21 domain-containing protein At4g14240.	No verified direct reference in this release
`At1g03270`	Putative DUF21 domain-containing protein At1g03270.	No verified direct reference in this release
`At4g14230`	DUF21 domain-containing protein At4g14230.	No verified direct reference in this release
`At4g33700`	DUF21 domain-containing protein At4g33700.	No verified direct reference in this release
`At5g52790`	DUF21 domain-containing protein At5g52790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036993 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010960 magnesium ion homeostasis Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G03270

ath:AT2G14520

ath:AT4G14230

ath:AT4G14240

ath:AT4G33700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.334

Rank 1 · TkA04G011710 · TK1151

Endoplasmic reticulum0.226

Rank 2 · TkA04G011710 · TK1151

Golgi apparatus0.220

Rank 3 · TkA04G011710 · TK1151

Lysosome / Vacuole0.191

Rank 4 · TkA04G011710 · TK1151

Cytoplasm0.154

Rank 5 · TkA04G011710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01595CNNM104-274 aa

PF00571CBS312-347 aa

PF00571CBS355-390 aa

PF00571CBS459-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G011710	`PF01595`	CNNM	104	274	2.3e-32	112.8
TkA04G011710	`PF00571`	CBS	312	347	6.4e-08	33.5
TkA04G011710	`PF00571`	CBS	355	390	6.4e-08	33.5
TkA04G011710	`PF00571`	CBS	459	477	6.4e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XQ0`	Arabidopsis thaliana	sp\|Q67XQ0\|Y4424_ARATH DUF21 domain-containing protein At4g14240	74.800%	Swiss-Prot	High
`Q9ZVS8`	Arabidopsis thaliana	sp\|Q9ZVS8\|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270	69.300%	Swiss-Prot	High
`Q4V3C7`	Arabidopsis thaliana	sp\|Q4V3C7\|Y4423_ARATH DUF21 domain-containing protein At4g14230	69.300%	Swiss-Prot	High
`Q8VZI2`	Arabidopsis thaliana	sp\|Q8VZI2\|Y4370_ARATH DUF21 domain-containing protein At4g33700	54.600%	Swiss-Prot	High
`Q9LTD8`	Arabidopsis thaliana	sp\|Q9LTD8\|Y5279_ARATH DUF21 domain-containing protein At5g52790	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card