TkA04G010160 | RubberDandelionOmics

Gene overview

TkA04G010160

Reference: TK1151 Chr: Chr04 Coordinates: 2398315-2405518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · TkA04G010160|TK1151|cDNA

ATGGCTACAGTTGCAGCTTTGGTGAATGAAAGGTCGGTGGTTATATTCAGCAAAACTTCTTGCTGCATGTGTCATACCATTCAGACATTGATAAGTAGTTTTGGAGCAAATCCAACGGTTTATGAGATAGATGAGCATCCAAGGGGACAACAAATAGAGAAGGAGCTGAAGGGATTAGGATGTAAGCCAAGTGTACCAGTTGTGTTCATAGGGCAGCAGCTGATTGGTGGGGCCAATGAGATCATGACCCTTCATCTCAA...

CDS

Download CDS FASTA

528 bp · TkA04G010160|TK1151|CDS

ATGGCTACAGTTGCAGCTTTGGTGAATGAAAGGTCGGTGGTTATATTCAGCAAAACTTCTTGCTGCATGTGTCATACCATTCAGACATTGATAAGTAGTTTTGGAGCAAATCCAACGGTTTATGAGATAGATGAGCATCCAAGGGGACAACAAATAGAGAAGGAGCTGAAGGGATTAGGATGTAAGCCAAGTGTACCAGTTGTGTTCATAGGGCAGCAGCTGATTGGTGGGGCCAATGAGATCATGACCCTTCATCTCAA...

Protein

Download Protein FASTA

175 aa · TkA04G010160|TK1151|PROTEIN

MATVAALVNERSVVIFSKTSCCMCHTIQTLISSFGANPTVYEIDEHPRGQQIEKELKGLGCKPSVPVVFIGQQLIGGANEIMTLHLKGQLVPLLLSSNAIWTLISSFGANPTVYEIDEHPRGQQIEKELKGLGCKPSVPVVFIGQQLIGGANEIMTLHLKGQLVPLLLSSNAIWV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G010160`
TK1151 ID	TkA04G010160
OH-1004 ID	LXL04_037026
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 57.714 / OH-1004 99.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G010160

Location Chr04:2398315-2405518 (+)

Description Similar to GRXS6: Monothiol glutaredoxin-S6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62930`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At5g18600`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15680`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15700`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15690`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037026 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT3G62930

ath:AT4G15680

ath:AT4G15690

ath:AT4G15700

ath:AT5G18600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.709

Rank 1 · TkA04G010160 · TK1151

Nucleus0.463

Rank 2 · TkA04G010160 · TK1151

Mitochondrion0.104

Rank 3 · TkA04G010160 · TK1151

Cell membrane0.064

Rank 4 · TkA04G010160 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA04G010160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462Glutaredoxin13-75 aa

PF05768Glrx-like13-38 aa

PF19344TetR_C_3225-67 aa

PF19046GM130_C37-66 aa

PF13409GST_N_239-82 aa

PF00462Glutaredoxin98-148 aa

PF19344TetR_C_3299-140 aa

PF19046GM130_C110-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G010160	`PF00462`	Glutaredoxin	13	75	4.4e-24	85.2
TkA04G010160	`PF05768`	Glrx-like	13	38	0.0078	17.2
TkA04G010160	`PF19344`	TetR_C_32	25	67	0.049	14.5
TkA04G010160	`PF19046`	GM130_C	37	66	2.3e-05	24.8
TkA04G010160	`PF13409`	GST_N_2	39	82	0.0052	18.1
TkA04G010160	`PF00462`	Glutaredoxin	98	148	4.4e-24	85.2
TkA04G010160	`PF19344`	TetR_C_32	99	140	0.049	14.5
TkA04G010160	`PF19046`	GM130_C	110	139	2.3e-05	24.8
TkA04G010160	`PF13409`	GST_N_2	113	155	0.0052	18.1
TkA04G010160	`PF05768`	Glrx-like	136	145	0.0078	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYC8`	Arabidopsis thaliana	sp\|Q9LYC8\|GRXS6_ARATH Monothiol glutaredoxin-S6	62.400%	Swiss-Prot	Medium
`Q8L8Z8`	Arabidopsis thaliana	sp\|Q8L8Z8\|GRXS2_ARATH Monothiol glutaredoxin-S2	58.400%	Swiss-Prot	Medium
`O23419`	Arabidopsis thaliana	sp\|O23419\|GRXS4_ARATH Monothiol glutaredoxin-S4	61.100%	Swiss-Prot	Medium
`O23421`	Arabidopsis thaliana	sp\|O23421\|GRXS3_ARATH Monothiol glutaredoxin-S3	57.400%	Swiss-Prot	Medium
`O23420`	Arabidopsis thaliana	sp\|O23420\|GRXS5_ARATH Monothiol glutaredoxin-S5	57.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card