TkA04G004050 | RubberDandelionOmics

Gene overview

TkA04G004050

Reference: TK1151 Chr: Chr04 Coordinates: 977553-981858 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2452 bp · TkA04G004050|TK1151|cDNA

TTTAGAAACCGCTAGCCGTTGCTTTCATTGGCCCCTACATGCATCAGTCTTTATATTTCCATGTTCCAACTACAAAGTTTCTGTACAAATAGGATCCCTCTCTTTCATTTCTCCAATCAGCTTACGATCGTCACAGCTAACAATCTTTTTTCTTAGTTCTAAGTTCTAAGTTCTAACAGTTGAGTTTCTTCAGGAGGTGGGAGATGACTATGCAGTTTGCAGTGACGGTGGAGGAAGGAAGAAAAGGCGTCGATGGCGAG...

CDS

Download CDS FASTA

1983 bp · TkA04G004050|TK1151|CDS

ATGACTATGCAGTTTGCAGTGACGGTGGAGGAAGGAAGAAAAGGCGTCGATGGCGAGCCATCTGTTGGTCCGATTTACCGTAATCTTCTAGCAAAAGATGGGTTTCCCCCTCTTGATGCTGAATTAAAAACTACTTGGGATGTCTTTAGGAATTCTGTTGAGAAGTATCCTAACAACAGGATGCTTGGATGGCGTGAGCCTGTTGACGGCAGCTGGGGTCCATATATATGGAAAACTTACAAGACCGTATACGACGAAGT...

Protein

Download Protein FASTA

660 aa · TkA04G004050|TK1151|PROTEIN

MTMQFAVTVEEGRKGVDGEPSVGPIYRNLLAKDGFPPLDAELKTTWDVFRNSVEKYPNNRMLGWREPVDGSWGPYIWKTYKTVYDEVLHTASAIRASGIGPGCKVGIYGSNCPQWIVAMEACNAQSYISVPLYDTLGSGAVNFILDHAEVDVVFVQDKKVKELLNPECTHTQRLKLIVCFTSMKEEEKEKADSMGIKSYSWTEFLHMGSKNPSEVQTPKVSDICTIMYTSGTSGDPKGVILTHENVTTNIRGVDLFMEQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G004050`
TK1151 ID	TkA04G004050
OH-1004 ID	LXL04_037092
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G004050

Location Chr04:977553-981858 (-)

Description Similar to LACS1: Long chain acyl-CoA synthetase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47240`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	Leaf Epicuticular Waxes of the Eceriferum Mutants in Arabidopsis.1995 · DOI: 10.1104/pp.108.1.369 Arabidopsis CER8 encodes LONG-CHAIN ACYL-COA SYNTHETASE 1 (LACS1) that has overlapping functions with LACS2 in plant wax and cutin synthesis.2009 · DOI: 10.1111/j.1365-313x.2009.03892.x Organ fusion and defective cuticle function in a lacs1 lacs2 double mutant of Arabidopsis.2010 · DOI: 10.1007/s00425-010-1110-4
`At4g23850`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At1g64400`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At4g11030`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037092 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0080024 indolebutyric acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64400

ath:AT2G47240

ath:AT4G11030

ath:AT4G23850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.400

Rank 1 · TkA04G004050 · TK1151

Cytoplasm0.295

Rank 2 · TkA04G004050 · TK1151

Cell membrane0.135

Rank 3 · TkA04G004050 · TK1151

Mitochondrion0.133

Rank 4 · TkA04G004050 · TK1151

Peroxisome0.106

Rank 5 · TkA04G004050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding49-481 aa

PF20683DUF6819320-372 aa

PF13193AMP-binding_C533-567 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G004050	`PF00501`	AMP-binding	49	481	1.6e-80	271.5
TkA04G004050	`PF20683`	DUF6819	320	372	0.072	13.5
TkA04G004050	`PF13193`	AMP-binding_C	533	567	0.0049	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22898`	Arabidopsis thaliana	sp\|O22898\|LACS1_ARATH Long chain acyl-CoA synthetase 1	65.400%	Swiss-Prot	High
`Q9T0A0`	Arabidopsis thaliana	sp\|Q9T0A0\|LACS4_ARATH Long chain acyl-CoA synthetase 4	49.800%	Swiss-Prot	Medium
`Q9C7W4`	Arabidopsis thaliana	sp\|Q9C7W4\|LACS3_ARATH Long chain acyl-CoA synthetase 3	49.100%	Swiss-Prot	Medium
`Q9T009`	Arabidopsis thaliana	sp\|Q9T009\|LACS5_ARATH Long chain acyl-CoA synthetase 5	49.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card