TkA04G003500 | RubberDandelionOmics

Gene overview

TkA04G003500

Reference: TK1151 Chr: Chr04 Coordinates: 875672-877566 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1749 bp · TkA04G003500|TK1151|cDNA

AAATGGTATTCAAGGCTTTCCCTTACTCCCTCAAGCTTGTTCTCTTCGTCTCTCGACTTCTTCTAAAGCTCCACCAAAATCATACAAGAGCTCTTAAAAGAACCCTAAGCAACACCAATGCCTTCCATTTCAAATCACAAACCCCACTTTTAGTAGCTCAAGGATCCGATCTCTCACAAAAGACGTTGATCTTCGATGTCGAAGGAACCCTGTTAAAATCCTCTTCGGTGTTTCCATATTTCATGTTGGTTGCATTTGAG...

CDS

Download CDS FASTA

1608 bp · TkA04G003500|TK1151|CDS

ATGGTATTCAAGGCTTTCCCTTACTCCCTCAAGCTTGTTCTCTTCGTCTCTCGACTTCTTCTAAAGCTCCACCAAAATCATACAAGAGCTCTTAAAAGAACCCTAAGCAACACCAATGCCTTCCATTTCAAATCACAAACCCCACTTTTAGTAGCTCAAGGATCCGATCTCTCACAAAAGACGTTGATCTTCGATGTCGAAGGAACCCTGTTAAAATCCTCTTCGGTGTTTCCATATTTCATGTTGGTTGCATTTGAGGC...

Protein

Download Protein FASTA

535 aa · TkA04G003500|TK1151|PROTEIN

MVFKAFPYSLKLVLFVSRLLLKLHQNHTRALKRTLSNTNAFHFKSQTPLLVAQGSDLSQKTLIFDVEGTLLKSSSVFPYFMLVAFEAGSLIRAFVLFTLYPLLCLVNQDVSLKIMVTVCFFGIKKKDFRVGSSVLPKFFLEDVGMEGFHVLRRGNKKVGVSKLPQVMVECFLKDYLEIDYVFGRDLVVYGGYYVGLMKENNKNILKRRINDVLEKDEDATVCISNKSIKREWISCSKEVYVVTDGEKKAWRSLPKEEYPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G003500`
TK1151 ID	TkA04G003500
OH-1004 ID	LXL04_037099
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.813 / OH-1004 99.813 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G003500

Location Chr04:875672-877566 (+)

Description Similar to GPAT3: Probable glycerol-3-phosphate acyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01950`	Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.	No verified direct reference in this release
`At1g02390`	Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.	No verified direct reference in this release
`At1g06520`	Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.	Arabidopsis AtGPAT1, a member of the membrane-bound glycerol-3-phosphate acyltransferase gene family, is essential for tapetum differentiation and male fertility.2003 · DOI: 10.1105/tpc.012427
`UniProt: Q5XF03`	Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037099 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0016024 CDP-diacylglycerol biosynthetic process Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0004366 glycerol-3-phosphate O-acyltransferase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

GO:0090447 glycerol-3-phosphate 2-O-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02390

ath:AT1G06520

ath:AT4G01950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.537

Rank 1 · TkA04G003500 · TK1151

Golgi apparatus0.141

Rank 2 · TkA04G003500 · TK1151

Nucleus0.123

Rank 3 · TkA04G003500 · TK1151

Plastid0.066

Rank 4 · TkA04G003500 · TK1151

Cell membrane0.064

Rank 5 · TkA04G003500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23270HAD_RAM2_N61-242 aa

PF12710HAD63-224 aa

PF01553Acyltransferase336-439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G003500	`PF23270`	HAD_RAM2_N	61	242	2e-68	230.5
TkA04G003500	`PF12710`	HAD	63	224	0.00011	23.4
TkA04G003500	`PF01553`	Acyltransferase	336	439	5.1e-11	43.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYJ2`	Arabidopsis thaliana	sp\|Q9SYJ2\|GPAT3_ARATH Probable glycerol-3-phosphate acyltransferase 3	56.900%	Swiss-Prot	High
`Q9FZ22`	Arabidopsis thaliana	sp\|Q9FZ22\|GPAT2_ARATH Probable glycerol-3-phosphate acyltransferase 2	54.800%	Swiss-Prot	High
`Q9SHJ5`	Arabidopsis thaliana	sp\|Q9SHJ5\|GPAT1_ARATH Glycerol-3-phosphate acyltransferase 1	45.200%	Swiss-Prot	Medium
`Q5XF03`	Arabidopsis thaliana	sp\|Q5XF03\|GPAT8_ARATH Probable glycerol-3-phosphate acyltransferase 8	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card