TkA04G000970 | RubberDandelionOmics

Gene overview

TkA04G000970

Reference: TK1151 Chr: Chr04 Coordinates: 245312-245782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

471 bp · TkA04G000970|TK1151|cDNA

ATGAAGCTTGTGTTTTTTGCCAACTGCCGTCAGCTGGTGGATCCACCATTACCACAAGGTTTCTACTGGAACTGTTTCTTCCCGGTGACTATCAGTGCATCTAGCGATGCCTTGGCCCAATTACCGACAATTGAGGTGGTGAGAATGATCCAGGAGGCCAAGGCCAGGCTGCCTAGAGAATTTGCAGATTGGGTTAGTAATGAAGAAGGTGGGAAGAAGGAAGACCCATTTGCACCACCGCTGGGATACACAACCTTGTT...

CDS

Download CDS FASTA

471 bp · TkA04G000970|TK1151|CDS

ATGAAGCTTGTGTTTTTTGCCAACTGCCGTCAGCTGGTGGATCCACCATTACCACAAGGTTTCTACTGGAACTGTTTCTTCCCGGTGACTATCAGTGCATCTAGCGATGCCTTGGCCCAATTACCGACAATTGAGGTGGTGAGAATGATCCAGGAGGCCAAGGCCAGGCTGCCTAGAGAATTTGCAGATTGGGTTAGTAATGAAGAAGGTGGGAAGAAGGAAGACCCATTTGCACCACCGCTGGGATACACAACCTTGTT...

Protein

Download Protein FASTA

156 aa · TkA04G000970|TK1151|PROTEIN

MKLVFFANCRQLVDPPLPQGFYWNCFFPVTISASSDALAQLPTIEVVRMIQEAKARLPREFADWVSNEEGGKKEDPFAPPLGYTTLFISEWGRLGFNQVDYGTGHPSLFRCRAQASYLLQSSAACLAKQRNTSHDMVRPEAPYSAFNFMPLLYNFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G000970`
TK1151 ID	TkA04G000970
OH-1004 ID	LXL04_037135
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 67.949 / OH-1004 24.537 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G000970

Location Chr04:245312-245782 (-)

Description Similar to AT4: Acyl transferase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0278500`	Involved in the incorporation of ferulate into the cell wall.	No verified direct reference in this release
`Os01g0291500`	Grass-specific monolignol p-coumaroyl transferase involved in the biosynthesis of acylated monolignols or monolignol conjugates that serve as monomer precursors of lignin.	No verified direct reference in this release
`Os06g0594600`	Involved in the incorporation of ferulate into the cell wall.	Overexpression of a BAHD acyltransferase, OsAt10, alters rice cell wall hydroxycinnamic acid content and saccharification.2013 · DOI: 10.1104/pp.112.208694
`Os01g0185300`	Involved in the incorporation of ferulate into the cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0016746 acyltransferase activity Molecular Function

GO:0050734 hydroxycinnamoyltransferase activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0185300

dosa:Os01g0291500

dosa:Os05g0179300

dosa:Os05g0278500

osa:4325654

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.407

Rank 1 · TkA04G000970 · TK1151

Cytoplasm0.224

Rank 2 · TkA04G000970 · TK1151

Nucleus0.157

Rank 3 · TkA04G000970 · TK1151

Cell membrane0.114

Rank 4 · TkA04G000970 · TK1151

Golgi apparatus0.114

Rank 5 · TkA04G000970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase2-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G000970	`PF02458`	Transferase	2	109	3.5e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0DJH7`	Oryza sativa subsp. japonica	sp\|Q0DJH7\|AT5_ORYSJ Acyl transferase 5	45.000%	Swiss-Prot	Medium
`Q5JNT2`	Oryza sativa subsp. japonica	sp\|Q5JNT2\|AT4_ORYSJ Acyl transferase 4	44.100%	Swiss-Prot	Medium
`Q69UE6`	Oryza sativa subsp. japonica	sp\|Q69UE6\|AT10_ORYSJ Acyl transferase 10	38.100%	Swiss-Prot	Medium
`Q9LGQ6`	Oryza sativa subsp. japonica	sp\|Q9LGQ6\|AT9_ORYSJ Acyl transferase 9	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card