TkA03G615000 | RubberDandelionOmics

Gene overview

TkA03G615000

Reference: TK1151 Chr: Chr03 Coordinates: 156222798-156230251 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3463 bp · TkA03G615000|TK1151|cDNA

ATTACCTCAACATAGGTCGTACACACGAAATCATCGTCATTTCTCTCTGGTCATTCTTTGACTTTCTCTCTCATATTTACAAATATACGTTTTCCCCATTGATTAATTGTTGATTCATGAAGAGATTCCATCTCCATAGACATTCTCCTTCTCTCTTTATATAAATCCTACACACGAAACCATCGTCATTTCTCTCTGGTCATTCTTTATTTTTCTCTCTCATATTTACAAATTTACGTTTTTCATTGATTCATGAAGAG...

CDS

Download CDS FASTA

2886 bp · TkA03G615000|TK1151|CDS

ATGGGAGGTTCTGAAGATGATATGGCGTCGTCGGCACGGAAAGGAGGTGGGAGATACGACCCAGCCCATGATAATGCTCCCGTCGTCCTGGAGATGTCCTCCATTGATCCTGGATCTTCATCTTCTTTGAAGAAAGGGAAAGCAGGGCAGCGAAGCCCTGGTGGAGGTACAAAAGAAGACACAATGCGCAACGGGGGAGAATCTAAGCTCGAGTTATTTGGATTTGATTCTCTTGTAAATACTCTTGGTCTTAAAAGCAT...

Protein

Download Protein FASTA

961 aa · TkA03G615000|TK1151|PROTEIN

MGGSEDDMASSARKGGGRYDPAHDNAPVVLEMSSIDPGSSSSLKKGKAGQRSPGGGTKEDTMRNGGESKLELFGFDSLVNTLGLKSMTGEQVQVTSSPKQVDDAKHPKLPKTGNKNKLGTLMGVFIPCLQNILGIIYYIRFSWIVGIAGIGQSLLLVSLCALCTFLTSISLSAIATNGAMKGGGPYYLIGRALGPEVGVSIGLCFFLGTAVAGAMYVLGAVETFLGAVPKASIFKDTITQTDGVGVAGAPNIHDLQVYGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G615000`
TK1151 ID	TkA03G615000
OH-1004 ID	LXL04_011727
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G615000

Location Chr03:156222798-156230251 (+)

Description Similar to CCC1: Cation-chloride cotransporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30450`	Cation/chloride cotransporter that mediates potassium-chloride and sodium-chloride cotransports.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0323700`	Probable cation/chloride cotransporter that may mediate potassium-chloride cotransport.	Cloning and functional characterization of a cation-chloride cotransporter gene OsCCC1.2011 · DOI: 10.1007/s11103-011-9744-6
`Os01g0304100`	Probable cation/chloride cotransporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0006884 cell volume homeostasis Biological Process

GO:0055064 chloride ion homeostasis Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:1902476 chloride transmembrane transport Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G30450

dosa:Os01g0304100

dosa:Os08g0323700

mmu:20498

rno:29501

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.704

Rank 1 · TkA03G615000 · TK1151

Cytoplasm0.175

Rank 2 · TkA03G615000 · TK1151

Endoplasmic reticulum0.109

Rank 3 · TkA03G615000 · TK1151

Lysosome / Vacuole0.082

Rank 4 · TkA03G615000 · TK1151

Golgi apparatus0.077

Rank 5 · TkA03G615000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00746Gram_pos_anchor104-126 aa

PF00324AA_permease123-588 aa

PF13520AA_permease_2132-554 aa

PF01235Na_Ala_symp177-297 aa

PF00746Gram_pos_anchor209-218 aa

PF01235Na_Ala_symp473-505 aa

PF03522SLC12629-750 aa

PF08030NAD_binding_6732-809 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G615000	`PF00746`	Gram_pos_anchor	104	126	0.048	14.3
TkA03G615000	`PF00324`	AA_permease	123	588	3.3e-49	168.6
TkA03G615000	`PF13520`	AA_permease_2	132	554	1.6e-15	57.7
TkA03G615000	`PF01235`	Na_Ala_symp	177	297	1.1	8.7
TkA03G615000	`PF00746`	Gram_pos_anchor	209	218	0.048	14.3
TkA03G615000	`PF01235`	Na_Ala_symp	473	505	1.1	8.7
TkA03G615000	`PF03522`	SLC12	629	750	2.1e-42	146.4
TkA03G615000	`PF08030`	NAD_binding_6	732	809	0.32	11.8
TkA03G615000	`PF03522`	SLC12	760	960	2.1e-42	146.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2UVJ5`	Arabidopsis thaliana	sp\|Q2UVJ5\|CCC1_ARATH Cation-chloride cotransporter 1	74.000%	Swiss-Prot	High
`Q6Z0E2`	Oryza sativa subsp. japonica	sp\|Q6Z0E2\|CCC1_ORYSJ Cation-chloride cotransporter 1	73.000%	Swiss-Prot	High
`Q657W3`	Oryza sativa subsp. japonica	sp\|Q657W3\|CCC2_ORYSJ Cation-chloride cotransporter 2	71.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card