TkA03G609830 | RubberDandelionOmics

Gene overview

TkA03G609830

Reference: TK1151 Chr: Chr03 Coordinates: 154868286-154875204 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2937 bp · TkA03G609830|TK1151|cDNA

TCTCCGTCACTTGCAGAGGCTCCACCGACACCTCCATTCTGTTTTTTTTTTACTTTACATCTCTAGCTGCTTGACCAAGGCTTTCCATACTCGCCACACGTTTCTGCTTTTTGTGGACACGTGCTCTCCTCCATCAACCAGAGACTTCACTTCTAACCTTCACTTCCTCAGGTATATATCAACAATAAGCAACATTTTGGCAATATATTAGCGAATAAACCGCCGTTCCTTCCCATTTTGCACACACCAATTCCACGAAT...

CDS

Download CDS FASTA

2343 bp · TkA03G609830|TK1151|CDS

ATGACACTCTTTGCAAATCCAGTTAACCACACTTATGCATTCACAAAGAGAGTTAGGAAGAAAGAAAACATGATGAAGATGATGATGAATGTGCTATTGATTTCTTTAGTAATAGTCATATCCGCCATTGATGAAGACCGAAAGGTTTTTATAGCTTACATGGGATTTCTCCCGGAAGGCGAATACTCACCTTCGTTGCATCACTATGAAATCCTGAAAAAGGTTACCAACCCCAGGTTTGCAAGAAAATCTCTAATAAG...

Protein

Download Protein FASTA

780 aa · TkA03G609830|TK1151|PROTEIN

MTLFANPVNHTYAFTKRVRKKENMMKMMMNVLLISLVIVISAIDEDRKVFIAYMGFLPEGEYSPSLHHYEILKKVTNPRFARKSLIRSYHRSFNGFAAYLSQEEQQKLAGLDGVISVFPCQKLRLQTTRSWDFMGLPTTTERSVTGESDTIIGVIDGGIWPESESFSGEGIGPIPGRWRGQCQGGKNFGCNRKIIGARYYGAIDSVRDRFGHGTHVASIIAGSQVNNASYYGVAQGIARGGVPSARLAVYKACDQACDLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G609830`
TK1151 ID	TkA03G609830
OH-1004 ID	LXL04_011671
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G609830

Location Chr03:154868286-154875204 (-)

Description Similar to SBT4.4: Subtilisin-like protease SBT4.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59190`	Subtilisin-like protease SBT4.3.	No verified direct reference in this release
`At5g59100`	Subtilisin-like protease SBT4.4.	No verified direct reference in this release
`At3g46850`	Subtilisin-like protease SBT4.6.	No verified direct reference in this release
`At3g46840`	Subtilisin-like protease SBT4.5.	No verified direct reference in this release
`At5g59120`	Subtilisin-like protease SBT4.13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011671 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46840

ath:AT3G46850

ath:AT5G59100

ath:AT5G59130

ath:AT5G59190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.294

Rank 1 · TkA03G609830 · TK1151

Cell membrane0.280

Rank 2 · TkA03G609830 · TK1151

Lysosome / Vacuole0.151

Rank 3 · TkA03G609830 · TK1151

Cytoplasm0.113

Rank 4 · TkA03G609830 · TK1151

Endoplasmic reticulum0.101

Rank 5 · TkA03G609830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07185DUF140415-42 aa

PF05922Inhibitor_I961-125 aa

PF21864MORF_dom77-126 aa

PF00082Peptidase_S8148-583 aa

PF17766fn3_6311-333 aa

PF07185DUF1404323-362 aa

PF02225PA368-432 aa

PF17766fn3_6629-728 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G609830	`PF07185`	DUF1404	15	42	0.00068	20.1
TkA03G609830	`PF05922`	Inhibitor_I9	61	125	1.8e-10	42.1
TkA03G609830	`PF21864`	MORF_dom	77	126	0.0074	16.8
TkA03G609830	`PF00082`	Peptidase_S8	148	583	8.5e-46	157.3
TkA03G609830	`PF17766`	fn3_6	311	333	1.4e-23	83.6
TkA03G609830	`PF07185`	DUF1404	323	362	0.00068	20.1
TkA03G609830	`PF02225`	PA	368	432	8.7e-05	23.3
TkA03G609830	`PF17766`	fn3_6	629	728	1.4e-23	83.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIF8`	Arabidopsis thaliana	sp\|Q9FIF8\|SBT43_ARATH Subtilisin-like protease SBT4.3	51.200%	Swiss-Prot	High
`Q9FGU3`	Arabidopsis thaliana	sp\|Q9FGU3\|SBT44_ARATH Subtilisin-like protease SBT4.4	50.900%	Swiss-Prot	High
`Q9STF7`	Arabidopsis thaliana	sp\|Q9STF7\|SBT46_ARATH Subtilisin-like protease SBT4.6	49.600%	Swiss-Prot	Medium
`F4JA91`	Arabidopsis thaliana	sp\|F4JA91\|SBT45_ARATH Subtilisin-like protease SBT4.5	49.700%	Swiss-Prot	Medium
`Q9FIG2`	Arabidopsis thaliana	sp\|Q9FIG2\|SBT4D_ARATH Subtilisin-like protease SBT4.13	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card