TkA03G608900 | RubberDandelionOmics

Gene overview

TkA03G608900

Reference: TK1151 Chr: Chr03 Coordinates: 154625306-154627804 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1832 bp · TkA03G608900|TK1151|cDNA

TTAATTAGGGTCCAAATTAAATAAATCATAACCTTGAGTGGTCTAACTAGAATATTCGCTACTTTAAACACCGGGGACCGTTGGTTACTAGTACGAGCTTACTGCCGGCGCCAAATATTCGTCTTCCTCCCTCTCTTATAACACTGCAAAACCTCAGTCGATTTCCGAACTCCCAAACTCCCTCAATCTCTTGATCGGAGATCTAGTTCTTCACAGCCGGCCGTTCGCCTGAGGATTTTGCTGTTAATCGTTTGACTAAT...

CDS

Download CDS FASTA

1404 bp · TkA03G608900|TK1151|CDS

ATGGCAGAGGGAATAAATGGATTTTCATCGCCGAGAGCGGATGTTTTTCCAGCAGGACTTCGTGTCCTTGTCGTCGATGATGATCCTACTTGGTTGAAAATTCTAGAGAAGATGCTCAAGAAGTGCTCTTATGAAGTTACTACATGTGGACTAGCAATCGAGGCTCTGGATATTCTCCGCGAAAAAAAAGATGGGTTTGACATTGTAGTCAGTGATGTCAACATGCCTGACATGGATGGCTTCAAGCTTTTGGAGCATGT...

Protein

Download Protein FASTA

467 aa · TkA03G608900|TK1151|PROTEIN

MAEGINGFSSPRADVFPAGLRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAIEALDILREKKDGFDIVVSDVNMPDMDGFKLLEHVGLEMDLPVIMMSVDGETSRVMRGVQHGACDYLLKPIRMKELRNIWQHVYRKKIHEVRDGESHECLEEILMMRNVSEQSDDGYLLCGSDLTPGKKRKNADHNNYYDKDFLDHSSVKKARVVWTVDLHQKFVKAVNHIGFEIGPKKILDLMNVPWLTRENVASHLQKYRLYLTRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G608900`
TK1151 ID	TkA03G608900
OH-1004 ID	LXL04_022508
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.600
Protein coverage (%)	TK1151 52.891 / OH-1004 52.459 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G608900

Location Chr03:154625306-154627804 (+)

Description Similar to RR21: Two-component response regulator ORR21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67710`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.2003 · DOI: 10.1093/pcp/pcg014
`At2g01760`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0904700`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: B8AEH1`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os02g0796500`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022508 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT2G01760

ath:AT3G16857

ath:AT4G16110

dosa:Os03g0224200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA03G608900 · TK1151

Cytoplasm0.082

Rank 2 · TkA03G608900 · TK1151

Cell membrane0.031

Rank 3 · TkA03G608900 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA03G608900 · TK1151

Plastid0.014

Rank 5 · TkA03G608900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29701TP_0454_N20-64 aa

PF00072Response_reg22-131 aa

PF00249Myb_DNA-binding31-45 aa

PF00249Myb_DNA-binding205-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G608900	`PF29701`	TP_0454_N	20	64	0.049	14.2
TkA03G608900	`PF00072`	Response_reg	22	131	2e-24	86.6
TkA03G608900	`PF00249`	Myb_DNA-binding	31	45	4.4e-07	30.6
TkA03G608900	`PF00249`	Myb_DNA-binding	205	254	4.4e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXD6`	Arabidopsis thaliana	sp\|Q9FXD6\|ARR11_ARATH Two-component response regulator ARR11	72.400%	Swiss-Prot	Medium
`Q8L9Y3`	Arabidopsis thaliana	sp\|Q8L9Y3\|ARR14_ARATH Two-component response regulator ARR14	53.200%	Swiss-Prot	Medium
`Q5N6V8`	Oryza sativa subsp. japonica	sp\|Q5N6V8\|ORR26_ORYSJ Two-component response regulator ORR26	73.100%	Swiss-Prot	Medium
`B8AEH1`	Oryza sativa subsp. indica	sp\|B8AEH1\|ORR23_ORYSI Two-component response regulator ORR23	57.400%	Swiss-Prot	Medium
`Q6K8X6`	Oryza sativa subsp. japonica	sp\|Q6K8X6\|ORR23_ORYSJ Two-component response regulator ORR23	57.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card