TkA03G608590 | RubberDandelionOmics

Gene overview

TkA03G608590

Reference: TK1151 Chr: Chr03 Coordinates: 154543262-154547278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2358 bp · TkA03G608590|TK1151|cDNA

AAATAGGAGGTGGTGAACTTGAATCATCAACCCAATAGACGACACATCATCAATTTTTCTCAGAGGAAACGTATACAAAAAGACCCCCAAATTGGATTTGACCCGTCCATTCATTCATCCCAAGATTACAATACACAACACAACCTCCTCATTTATCTCATCTTCCTCCCCTTTTTCATTCTTCATTCACTCATCAACAAATCCCTGTTTTCTCTCTCTAAAATCTTCCAATTTAACATACCCTCTCCCAACCATTATTG...

CDS

Download CDS FASTA

1608 bp · TkA03G608590|TK1151|CDS

ATGGACGCCACCACGAGTGGAACGCCAACCATTCAATACCACAACATCGCCGACCAACAGATTCCGACCACCGTCGCGGCTTCCACCCCGTCATTTAACCGGCAAACCCGCCATTGTTTTGGCGATGCAACTCCGGGAGAATTCCCATTATCTGCAAACCCCTCAATCGTTCTGCATGTTCTCACTGGTTGTAATCTAGAGCCACAAGATCTCGCAAAACTAGAGGCGACATGTTCTTTCTTTAGGCAGCCTGCCCATTT...

Protein

Download Protein FASTA

535 aa · TkA03G608590|TK1151|PROTEIN

MDATTSGTPTIQYHNIADQQIPTTVAASTPSFNRQTRHCFGDATPGEFPLSANPSIVLHVLTGCNLEPQDLAKLEATCSFFRQPAHFAPDHELCLSELAALDMCQKRAIFKPMDSEQRHQLKLRCGGSWKLVLRFLLAGETCSRREKSQAIAGPGHSIAVTSKGSVFTFGSNSSGQLGHDTTQEESTPRIIRSLQGIRIIHAAAGAGRTMLISDSGQVYAFGKDSFGEAEYGVQGSKQVNTPKLVESLKDIFVVQAAIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G608590`
TK1151 ID	TkA03G608590
OH-1004 ID	LXL04_011647
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G608590

Location Chr03:154543262-154547278 (+)

Description Similar to HERC2: E3 ubiquitin-protein ligase HERC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63860`	UV-B specific signaling component that acts as a UV-B photoreceptor and plays a key role in establishing UV-protective responses in plants.	A UV-B-specific signaling component orchestrates plant UV protection.2005 · DOI: 10.1073/pnas.0507187102 UV-B promotes rapid nuclear translocation of the Arabidopsis UV-B specific signaling component UVR8 and activates its function in the nucleus.2007 · DOI: 10.1105/tpc.107.053330 UV-B signaling pathways with different fluence-rate response profiles are distinguished in mature Arabidopsis leaf tissue by requirement for UVR8, HY5, and HYH.2008 · DOI: 10.1104/pp.107.108456 Interaction of COP1 and UVR8 regulates UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2009 · DOI: 10.1038/emboj.2009.4 UVR8 in Arabidopsis thaliana regulates multiple aspects of cellular differentiation during leaf development in response to ultraviolet B radiation.2009 · DOI: 10.1111/j.1469-8137.2009.02855.x Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2010 · DOI: 10.1073/pnas.0914532107 Functional interaction of the circadian clock and UV RESISTANCE LOCUS 8-controlled UV-B signaling pathways in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04573.x Perception of UV-B by the Arabidopsis UVR8 protein.2011 · DOI: 10.1126/science.1200660 UVR8 mediates UV-B-induced Arabidopsis defense responses against Botrytis cinerea by controlling sinapate accumulation.2012 · DOI: 10.1093/mp/sss025 C-terminal region of the UV-B photoreceptor UVR8 initiates signaling through interaction with the COP1 protein.2012 · DOI: 10.1073/pnas.1210898109 In vivo function of tryptophans in the Arabidopsis UV-B photoreceptor UVR8.2012 · DOI: 10.1105/tpc.112.101451 The UV-B photoreceptor UVR8 promotes photosynthetic efficiency in Arabidopsis thaliana exposed to elevated levels of UV-B.2012 · DOI: 10.1007/s11120-012-9785-y

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011647 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006974 DNA damage response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005814 centriole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

hsa:8924

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA03G608590 · TK1151

Nucleus0.313

Rank 2 · TkA03G608590 · TK1151

Mitochondrion0.129

Rank 3 · TkA03G608590 · TK1151

Cell membrane0.099

Rank 4 · TkA03G608590 · TK1151

Plastid0.065

Rank 5 · TkA03G608590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like56-85 aa

PF09717CPW_WPC84-130 aa

PF00415RCC1146-160 aa

PF25390WD40_RLD147-483 aa

PF26550Tricorn_2nd149-282 aa

PF13540RCC1_2152-176 aa

PF25384Alsin_RLD152-221 aa

PF00415RCC1163-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G608590	`PF12937`	F-box-like	56	85	0.16	12.4
TkA03G608590	`PF09717`	CPW_WPC	84	130	0.08	14.5
TkA03G608590	`PF00415`	RCC1	146	160	3.4e-68	226.8
TkA03G608590	`PF25390`	WD40_RLD	147	483	4.1e-73	247.5
TkA03G608590	`PF26550`	Tricorn_2nd	149	282	0.042	13.3
TkA03G608590	`PF13540`	RCC1_2	152	176	4.1e-35	119.4
TkA03G608590	`PF25384`	Alsin_RLD	152	221	7.5e-11	42.5
TkA03G608590	`PF00415`	RCC1	163	212	3.4e-68	226.8
TkA03G608590	`PF13938`	DUF4213	191	217	0.21	12.7
TkA03G608590	`PF13540`	RCC1_2	199	227	4.1e-35	119.4
TkA03G608590	`PF00415`	RCC1	215	266	3.4e-68	226.8
TkA03G608590	`PF13938`	DUF4213	244	272	0.21	12.7
TkA03G608590	`PF25384`	Alsin_RLD	245	288	7.5e-11	42.5
TkA03G608590	`PF13540`	RCC1_2	253	279	4.1e-35	119.4
TkA03G608590	`PF00415`	RCC1	269	318	3.4e-68	226.8
TkA03G608590	`PF13540`	RCC1_2	306	319	4.1e-35	119.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN03`	Arabidopsis thaliana	sp\|Q9FN03\|UVR8_ARATH Ultraviolet-B receptor UVR8	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card