TkA03G608380 | RubberDandelionOmics

Gene overview

TkA03G608380

Reference: TK1151 Chr: Chr03 Coordinates: 154497840-154500363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1965 bp · TkA03G608380|TK1151|cDNA

CCCGACCCGACCTCGGAATATGGGTTAAAAGAGCCTTGTTATAATTCTAGGGCAAAAATACTTCCAAGTTCCAAGCACACTCTGTGTGCCGATCTCACTGTTATTTTCGCTTCATTCGTCGATCTAAGACCTTAGTCGACTGAAAGATCTGCAAAAATGGCTTTAGCTTTCGATGAATATGGTCGGCCTTTCATAATACTGAGGGAACAAGAGAGTAAGAGTAGGTTAAGGGGTTTAGATGCACAGAAGTCTAACATCGC...

CDS

Download CDS FASTA

1608 bp · TkA03G608380|TK1151|CDS

ATGGCTTTAGCTTTCGATGAATATGGTCGGCCTTTCATAATACTGAGGGAACAAGAGAGTAAGAGTAGGTTAAGGGGTTTAGATGCACAGAAGTCTAACATCGCCGCCGGCGTCGCCGTTTCTCGCATCCTCCGTACATCTCTTGGTCCCAAAGGAATGGACAAGATGCTCCAGAGCCCCGACGGAGACATCACTATCACAAATGATGGCGCAACGATCCTGGAGCAGATGGATGTTGACAATCAAATTGGAAAACTTAT...

Protein

Download Protein FASTA

535 aa · TkA03G608380|TK1151|PROTEIN

MALAFDEYGRPFIILREQESKSRLRGLDAQKSNIAAGVAVSRILRTSLGPKGMDKMLQSPDGDITITNDGATILEQMDVDNQIGKLMVELSRSQDYEIGDGTTGVVVLAGALLEQAEKLLERGIHPIRVAEGFEISSRIAVDHLEQISHKFDFNATNIEPLVQTCMTTLSSKIVNRCKRSLAEIAVKAVMAVADLERKDVNLDLIKVEGKVGGKLEDTELIYGIIVDKDMSHPQMPKHIEDAKIAILTCPFEPPKPKTKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G608380`
TK1151 ID	TkA03G608380
OH-1004 ID	LXL04_011646
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G608380

Location Chr03:154497840-154500363 (+)

Description Similar to CCT5: T-complex protein 1 subunit epsilon

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24510`	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009615 response to virus Biological Process

GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process

GO:0050821 protein stabilization Biological Process

GO:1904871 positive regulation of protein localization to Cajal body Biological Process

GO:1904874 positive regulation of telomerase RNA localization to Cajal body Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005832 chaperonin-containing T-complex Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G24510

hsa:22948

mcf:101926268

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.811

Rank 1 · TkA03G608380 · TK1151

Nucleus0.251

Rank 2 · TkA03G608380 · TK1151

Mitochondrion0.062

Rank 3 · TkA03G608380 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA03G608380 · TK1151

Cell membrane0.043

Rank 5 · TkA03G608380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118Cpn60_TCP140-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G608380	`PF00118`	Cpn60_TCP1	40	531	3.7e-163	544.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04450`	Arabidopsis thaliana	sp\|O04450\|TCPE_ARATH T-complex protein 1 subunit epsilon	88.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card