TkA03G608350 | RubberDandelionOmics

Gene overview

TkA03G608350

Reference: TK1151 Chr: Chr03 Coordinates: 154489195-154492821 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1228 bp · TkA03G608350|TK1151|cDNA

AAAGGGGCGAAACAAAATAACAATTTAGGTATACGGTTTTTCAATTATTACTATAATTTTATCAAAGCTGCAGAAAGATAAGATCGTGATTTTGCTTTGAAGAACACCCACTGTAGATAGAGCGAGAGAGAGCGAGAAAGATACAGATTTTCATTTGTTAACCGGACCAATTTGCGTGAACTCTAGTCTCCTCTCAAAAACTTAAACCGGGTAACTTGTCGTTTATCTCATCTATCTCTTACGGGGTGTTGACTTAATGG...

CDS

Download CDS FASTA

1332 bp · TkA03G608350|TK1151|CDS

ATGGCCGAAGAGCAGTTAGACTATGGAGATGAGGAATTCACAGGATCACAAAAGATGCAATATCATGGAGACGGAGCAATTCCTGCACTTGCAGATGATGAAATTGGAGGAGAAGATGATGAATATGATGATCTTTACAATGATGTTAATGTAGGAGAAGGTTTCTTACAAATGCAAAGATCCGAATCACTTCCATCTACAAACATAGGAAACGGAAGTTTCCATGATCAAAAAGTTAATAATAATGTTCAAGAACCTCG...

Protein

Download Protein FASTA

443 aa · TkA03G608350|TK1151|PROTEIN

MAEEQLDYGDEEFTGSQKMQYHGDGAIPALADDEIGGEDDEYDDLYNDVNVGEGFLQMQRSESLPSTNIGNGSFHDQKVNNNVQEPRSEAMIPQDTNTNINTNTPNVAGEPPYPKEGVMSVDLLQKRMVPLPQKPPVDPVNEPPPMLNSNPGQQIPNMTPATRPMITENQTQTQPRQPGEGGATTLFVGELHWWTTDAELENVLSQYGRVKEIKFFDERASGKSKGYCQVEFYEAGPAAACKEGMNGYLFNGRPCVVAFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G608350`
TK1151 ID	TkA03G608350
OH-1004 ID	LXL04_011645
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	67.600
Protein coverage (%)	TK1151 79.910 / OH-1004 84.694 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G608350`
Location	Chr03:154489195-154492821 (+)
Description	Similar to CG7185: Cleavage and polyadenylation specificity factor subunit CG7185
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011645` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0031124 mRNA 3'-end processing Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process GO:0051262 protein tetramerization Biological Process GO:0051290 protein heterotetramerization Biological Process GO:0110104 mRNA alternative polyadenylation Biological Process GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	dme:Dmel_CG7185 hsa:79869 mmu:269061 pon:100172241 rno:365407 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA03G608350 · TK1151

Cytoplasm0.091

Rank 2 · TkA03G608350 · TK1151

Cell membrane0.029

Rank 3 · TkA03G608350 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA03G608350 · TK1151

Plastid0.008

Rank 5 · TkA03G608350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13893RRM_5184-272 aa

PF00076RRM_1186-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G608350	`PF13893`	RRM_5	184	272	0.19	12.1
TkA03G608350	`PF00076`	RRM_1	186	255	1e-13	51.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card