TkA03G603990 | RubberDandelionOmics

Gene overview

TkA03G603990

Reference: TK1151 Chr: Chr03 Coordinates: 153449517-153452083 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1450 bp · TkA03G603990|TK1151|cDNA

CAGATAAGACTTCTGACTGCATGTGACCTGTTCGGACCTCGCCTCGCGTCGTCTTCGCTCATCCTCCTCACAGCTCCGGCGGTGTTCCTTAGCTCCATCGCTAACTCCCCGGCGGCCTTCTTAATGGTCCGTTTCTTCACCGGATTCTCTTTATCCACCTTTGTTTCCACCCAGTTCTGGATGAGCTCCATGTTCTCCCCAGGAGTCGTTGGGACCGCCAACGGACTTTCCGGCGGCTGGGGTAACCTCGGCGGAGGAGC...

CDS

Download CDS FASTA

1251 bp · TkA03G603990|TK1151|CDS

CAGATAAGACTTCTGACTGCATGTGACCTGTTCGGACCTCGCCTCGCGTCGTCTTCGCTCATCCTCCTCACAGCTCCGGCGGTGTTCCTTAGCTCCATCGCTAACTCCCCGGCGGCCTTCTTAATGGTCCGTTTCTTCACCGGATTCTCTTTATCCACCTTTGTTTCCACCCAGTTCTGGATGAGCTCCATGTTCTCCCCAGGAGTCGTTGGGACCGCCAACGGACTTTCCGGCGGCTGGGGTAACCTCGGCGGAGGAGC...

Protein

Download Protein FASTA

416 aa · TkA03G603990|TK1151|PROTEIN

QIRLLTACDLFGPRLASSSLILLTAPAVFLSSIANSPAAFLMVRFFTGFSLSTFVSTQFWMSSMFSPGVVGTANGLSGGWGNLGGGATQLIMPLVYSLIHSQIGSTKFTAWRIAFFIPAIFQTLSAFAIFFLGQDMPDGNYVRLEKSGEKHKDNFSQVFYHAITNYRGWILALTYGYCFGVELTIDNIIAQYFYDRFNVNLHTAGIIAASFGLANLFSRPGGGILSDVVAKRFGMRGRLWTLWVVQMIGGLLCLLLGKIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G603990`
TK1151 ID	TkA03G603990
OH-1004 ID	LXL04_011594
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.798 / OH-1004 81.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G603990

Location Chr03:153449517-153452083 (-)

Description Similar to NRT2.5: High affinity nitrate transporter 2.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12940`	Nitrate transporter involved in the constitutive high- affinity transport system (cHATS) under long-term N starvation conditions.	Disruption of the nitrate transporter genes AtNRT2.1 and AtNRT2.2 restricts growth at low external nitrate concentration.2004 · DOI: 10.1007/s00425-004-1266-x The NRT2.5 and NRT2.6 genes are involved in growth promotion of Arabidopsis by the plant growth-promoting rhizobacterium (PGPR) strain Phyllobacterium brassicacearum STM196.2013 · DOI: 10.1111/nph.12158 The Arabidopsis nitrate transporter NRT2.5 plays a role in nitrate acquisition and remobilization in nitrogen-starved plants.2014 · DOI: 10.1111/tpj.12626 A 150 kDa plasma membrane complex of AtNRT2.5 and AtNAR2.1 is the major contributor to constitutive high-affinity nitrate influx in Arabidopsis thaliana.2015 · DOI: 10.1111/pce.12496
`At5g60770`	Involved in high-affinity nitrate transport.	Disruption of the nitrate transporter genes AtNRT2.1 and AtNRT2.2 restricts growth at low external nitrate concentration.2004 · DOI: 10.1007/s00425-004-1266-x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0704100`	Involved in nitrate transport, but does not seem to be able to mediate transport by its own.	Spatial expression and regulation of rice high-affinity nitrate transporters by nitrogen and carbon status.2011 · DOI: 10.1093/jxb/erq403
`Os02g0112100`	Involved in nitrate transport, but does not seem to be able to mediate transport by its own.	Spatial expression and regulation of rice high-affinity nitrate transporters by nitrogen and carbon status.2011 · DOI: 10.1093/jxb/erq403 Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges.2011 · DOI: 10.1111/j.1365-3040.2011.02335.x
`Os02g0112600`	Involved in nitrate transport, but does not seem to be able to mediate transport by its own.	Spatial expression and regulation of rice high-affinity nitrate transporters by nitrogen and carbon status.2011 · DOI: 10.1093/jxb/erq403 Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges.2011 · DOI: 10.1111/j.1365-3040.2011.02335.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011594 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0015112 nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12940

ath:AT5G60770

dosa:Os01g0704100

dosa:Os02g0112100

dosa:Os02g0112600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.391

Rank 1 · TkA03G603990 · TK1151

Lysosome / Vacuole0.230

Rank 2 · TkA03G603990 · TK1151

Cytoplasm0.215

Rank 3 · TkA03G603990 · TK1151

Endoplasmic reticulum0.138

Rank 4 · TkA03G603990 · TK1151

Golgi apparatus0.104

Rank 5 · TkA03G603990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_18-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G603990	`PF07690`	MFS_1	8	312	4.2e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPV5`	Arabidopsis thaliana	sp\|Q9LPV5\|NRT25_ARATH High affinity nitrate transporter 2.5	70.700%	Swiss-Prot	High
`Q9FJH8`	Arabidopsis thaliana	sp\|Q9FJH8\|NRT24_ARATH High affinity nitrate transporter 2.4	55.400%	Swiss-Prot	High
`Q94JG1`	Oryza sativa subsp. japonica	sp\|Q94JG1\|NRT23_ORYSJ High-affinity nitrate transporter 2.3	68.400%	Swiss-Prot	High
`P0DKG9`	Oryza sativa subsp. japonica	sp\|P0DKG9\|NRT21_ORYSJ High-affinity nitrate transporter 2.1	55.900%	Swiss-Prot	High
`P0DKH0`	Oryza sativa subsp. japonica	sp\|P0DKH0\|NRT22_ORYSJ High-affinity nitrate transporter 2.2	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card