TkA03G597240 | RubberDandelionOmics

Gene overview

TkA03G597240

Reference: TK1151 Chr: Chr03 Coordinates: 151641629-151644189 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1148 bp · TkA03G597240|TK1151|cDNA

AAAAATGTTAACTAGGGTCGCCCAAAGTGTACAAGAAATGACGCCTACACAACAAAACCTTATCAAGATTAGAAAACCACACCTCAAAACTCACAATCGCCATGGCAGCAGCAGCACCTACCTTTTCTATCACTGCTCCTCCGTCCTTCACACTCGCCGCTCCGAAACACCAATTTGCTACCAATTTCCGCTCGCTTCATCACCTAAACCTCCGTGTCCGCCTCCGTTACAGCACTACCTGCTTTTACAAAGTAGCAATC...

CDS

Download CDS FASTA

531 bp · TkA03G597240|TK1151|CDS

ATGTTAACTAGGGTCGCCCAAAGTGTACAAGAAATGACGCCTACACAACAAAACCTTATCAAGATTAGAAAACCACACCTCAAAACTCACAATCGCCATGGCAGCAGCAGCACCTACCTTTTCTATCACTGCTCCTCCGTCCTTCACACTCGCCGCTCCGAAACACCAATTTGCTACCAATTTCCGCTCGCTTCATCACCTAAACCTCCGTGTCCGCCTCCGTTACAGCACTACCTGCTTTTACAAAGTAGCAATCGAAC...

Protein

Download Protein FASTA

176 aa · TkA03G597240|TK1151|PROTEIN

MLTRVAQSVQEMTPTQQNLIKIRKPHLKTHNRHGSSSTYLFYHCSSVLHTRRSETPICYQFPLASSPKPPCPPPLQHYLLLQSSNRTRSQTTELEVDPDETILEKALETGMSVPHDCKLGVCMTCPAKLLSGSVDQSEGMLSDDVIERGYSLLCVSYPKSDCHIKVIPEEELLSLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G597240`
TK1151 ID	TkA03G597240
OH-1004 ID	LXL04_001349
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.300
Protein coverage (%)	TK1151 48.864 / OH-1004 57.516 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G597240

Location Chr03:151641629-151644189 (+)

Description Similar to Ferredoxin-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14890`	Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions (Probable).	FdC1, a novel ferredoxin protein capable of alternative electron partitioning, increases in conditions of acceptor limitation at photosystem I.2011 · DOI: 10.1074/jbc.m110.161562

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001349 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006124 ferredoxin metabolic process Biological Process

GO:0022900 electron transport chain Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

sly:778301

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA03G597240 · TK1151

Mitochondrion0.060

Rank 2 · TkA03G597240 · TK1151

Nucleus0.028

Rank 3 · TkA03G597240 · TK1151

Cytoplasm0.026

Rank 4 · TkA03G597240 · TK1151

Cell membrane0.009

Rank 5 · TkA03G597240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12355Dscam_C49-101 aa

PF00111Fer289-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G597240	`PF12355`	Dscam_C	49	101	0.026	16.2
TkA03G597240	`PF00111`	Fer2	89	159	2.4e-15	56.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23344`	Arabidopsis thaliana	sp\|O23344\|FDC1_ARATH Ferredoxin C 1, chloroplastic	79.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card