TkA03G596870 | RubberDandelionOmics

Gene overview

TkA03G596870

Reference: TK1151 Chr: Chr03 Coordinates: 151561386-151562560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA03G596870|TK1151|cDNA

ATGAATCAAACATTAGAGCTATGGAAGGAGATTCCAGTAGATACCGAGAAAACCATCATCTTGGAAACAGAAAAACGAGTTACAGAACAATCGATATCTAATAAAACACGCGAGGGCAGTTTCGTAAATTCAAGATTTGGTTCTCGTGTGGTTCCATATATTGATGATTGCGACTTGGACATAAACGGAAATACAATCGAATACGATCATGGAAACCAAAAAGAAGTTGAAGATATATCTCGAATCCAAAAACAGCTTGT...

CDS

Download CDS FASTA

486 bp · TkA03G596870|TK1151|CDS

ATGAATCAAACATTAGAGCTATGGAAGGAGATTCCAGTAGATACCGAGAAAACCATCATCTTGGAAACAGAAAAACGAGTTACAGAACAATCGATATCTAATAAAACACGCGAGGGCAGTTTCGTAAATTCAAGATTTGGTTCTCGTGTGGTTCCATATATTGATGATTGCGACTTGGACATAAACGGAAATACAATCGAATACGATCATGGAAACCAAAAAGAAGTTGAAGATATATCTCGAATCCAAAAACAGCTTGT...

Protein

Download Protein FASTA

161 aa · TkA03G596870|TK1151|PROTEIN

MNQTLELWKEIPVDTEKTIILETEKRVTEQSISNKTREGSFVNSRFGSRVVPYIDDCDLDINGNTIEYDHGNQKEVEDISRIQKQLVQIENQQSNLLNLLQEIHGSSRNGMSSLETRVNGLERALDEISGQKGKGNIVQCHLSVDPTNSGKKQVREEASSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G596870`
TK1151 ID	TkA03G596870
OH-1004 ID	LXL04_011514
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 72.671 / OH-1004 18.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G596870

Location Chr03:151561386-151562560 (+)

Description Similar to TOR1L4: TORTIFOLIA1-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62580`	TORTIFOLIA1-like protein 3.	No verified direct reference in this release
`At4g27060`	Plant-specific microtubule-associated protein (MAP) that regulates the orientation of cortical microtubules and the direction of organ growth.	Arabidopsis SPIRAL2 promotes uninterrupted microtubule growth by suppressing the pause state of microtubule dynamics.2008 · DOI: 10.1242/jcs.030221
`At1g50890`	Plant-specific microtubule-associated protein (MAP) that regulates the orientation of cortical microtubules and the direction of organ growth.	Arabidopsis SPIRAL2 promotes uninterrupted microtubule growth by suppressing the pause state of microtubule dynamics.2008 · DOI: 10.1242/jcs.030221
`At1g27210`	TORTIFOLIA1-like protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011514 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0010031 circumnutation Biological Process

GO:0170002 halotropism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G27210

ath:AT1G50890

ath:AT2G07170

ath:AT4G27060

ath:AT5G62580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.765

Rank 1 · TkA03G596870 · TK1151

Cytoplasm0.301

Rank 2 · TkA03G596870 · TK1151

Cell membrane0.036

Rank 3 · TkA03G596870 · TK1151

Mitochondrion0.032

Rank 4 · TkA03G596870 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA03G596870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26845Phage_phi29_DNA_rep112-35 aa

PF26845Phage_phi29_DNA_rep134-67 aa

PF05064Nsp1_C62-111 aa

PF14165YtzH69-115 aa

PF05714PFam54_6075-131 aa

PF26845Phage_phi29_DNA_rep181-109 aa

PF26845Phage_phi29_DNA_rep1109-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G596870	`PF26845`	Phage_phi29_DNA_rep1	12	35	0.093	14.0
TkA03G596870	`PF26845`	Phage_phi29_DNA_rep1	34	67	0.093	14.0
TkA03G596870	`PF05064`	Nsp1_C	62	111	0.098	13.2
TkA03G596870	`PF14165`	YtzH	69	115	0.032	15.3
TkA03G596870	`PF05714`	PFam54_60	75	131	0.044	14.1
TkA03G596870	`PF26845`	Phage_phi29_DNA_rep1	81	109	0.093	14.0
TkA03G596870	`PF26845`	Phage_phi29_DNA_rep1	109	133	0.093	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPR6`	Arabidopsis thaliana	sp\|Q6NPR6\|TORL3_ARATH TORTIFOLIA1-like protein 3	67.200%	Swiss-Prot	Low
`Q9T041`	Arabidopsis thaliana	sp\|Q9T041\|TOR1_ARATH Microtubule-associated protein TORTIFOLIA1	52.000%	Swiss-Prot	Low
`F4I6M4`	Arabidopsis thaliana	sp\|F4I6M4\|TORL1_ARATH TORTIFOLIA1-like protein 1	50.000%	Swiss-Prot	Low
`Q93ZH1`	Arabidopsis thaliana	sp\|Q93ZH1\|TORL4_ARATH TORTIFOLIA1-like protein 4	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card