Gene Card
Gene overview
cDNA / CDS / Protein Sequences
cDNA
No cDNA sequence is available for this reference.
999 bp · TkA03G593970|TK1151|CDS
ATGGTGTTCCATGGCGTAGGTCTCCGCCGTGCTCTGGAGCTAGCATTTTGTATTGCTGGTATTTGGTCGGCGTATATATATCAAGGCGTTCTTCAAGAGACCGTGTCTACTAAGGGATTTGGCCCTGACAAGGAGAGGTTTGAACACTTGGCATTCTTAAACCTAGCACAAAGTGCTGTTTGTTTACAATGGTCCTTCATTATGATAAAGCTGTGGGGCAGGGGTAAAGGTGTTCGTGCTCCATGGTGGAGTTATTGGAG...
Protein
Download Protein FASTA332 aa · TkA03G593970|TK1151|PROTEIN
MVFHGVGLRRALELAFCIAGIWSAYIYQGVLQETVSTKGFGPDKERFEHLAFLNLAQSAVCLQWSFIMIKLWGRGKGVRAPWWSYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGTLVYSIRYTFREYLCSLLVAGGVSIFALAKTNSKTINKLAHPNAPLGYGLCFLNLVFDGFTNATQDSISARYPKTNAWDMMLGMNLWGTVYNTVFMFGWPEASGYEAVQFCKHNPDAAWDILYYCLCGAIGQNF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G593970 |
|---|---|
| TK1151 ID | TkA03G593970 |
| OH-1004 ID | LXL04_011494 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 90.217Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G593970 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:150833961-150838334 (-) | |||||||||
| Description | Similar to UTR3: UDP-galactose/UDP-glucose transporter 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0015780 nucleotide-sugar transmembrane transport Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0072334 UDP-galactose transmembrane transport Biological Process GO:0120112 UDP-glucose transmembrane transport into endoplasmic reticulum Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0005459 UDP-galactose transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G14360 ath:AT2G02810 ddi:DDB_G0288927 ddi:DDB_G0288929 mmu:110172 yli:2912920 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08449UAA14-317 aaPF00892EamA18-25 aaPF00892EamA66-152 aaPF00892EamA208-313 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G593970 | PF08449 | UAA | 14 | 317 | 5.8e-75 | 253.0 |
| TkA03G593970 | PF00892 | EamA | 18 | 25 | 2e-08 | 35.3 |
| TkA03G593970 | PF00892 | EamA | 66 | 152 | 2e-08 | 35.3 |
| TkA03G593970 | PF00892 | EamA | 208 | 313 | 2e-08 | 35.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.