TkA03G591860 | RubberDandelionOmics

Gene overview

TkA03G591860

Reference: TK1151 Chr: Chr03 Coordinates: 150327411-150327849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

376 bp · TkA03G591860|TK1151|cDNA

AACCATTCCAAGTTTCTCTCCATTCCCTCACATCATTTGGCTGAACAAAATGGTTGTTAATCGGAGACATATTGCACAAATATTGGAGATGGAAAGTATCTCTACTAATCAGGAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTCCAACTCGATCATGGTTCTGGATGGTGTTATGCTTCATGCAGTAAATGCAACAAGAATTTGGACGCCATCGATGGTTCATTTGTTTGCTCCATCTGCAATCAAGAATGTCGTT...

CDS

Download CDS FASTA

327 bp · TkA03G591860|TK1151|CDS

ATGGTTGTTAATCGGAGACATATTGCACAAATATTGGAGATGGAAAGTATCTCTACTAATCAGGAGGATAACGAGTTTACCGTCTTAGCAAAGATAGTCCAACTCGATCATGGTTCTGGATGGTGTTATGCTTCATGCAGTAAATGCAACAAGAATTTGGACGCCATCGATGGTTCATTTGTTTGCTCCATCTGCAATCAAGAATGTCGTTATCTCATCATAAGGTATAAAATACATGTGCATGTTATTGACGAAAGTGG...

Protein

Download Protein FASTA

109 aa · TkA03G591860|TK1151|PROTEIN

MVVNRRHIAQILEMESISTNQEDNEFTVLAKIVQLDHGSGWCYASCSKCNKNLDAIDGSFVCSICNQECRYLIIRYKIHVHVIDESGRTTFVIFNQEADKLLDSYANKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G591860`
TK1151 ID	TkA03G591860
OH-1004 ID	LXL04_001222
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 26.139 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G591860`
Location	Chr03:150327411-150327849 (+)
Description	Similar to Anthocyanin 3'-O-beta-glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001222` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008202 steroid metabolic process Biological Process GO:0010294 abscisic acid glucosyltransferase activity Molecular Function GO:0033837 anthocyanin 3'-O-beta-glucosyltransferase activity Molecular Function GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0050275 scopoletin glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:BAB83692 ag:BAC54092 var:108341782 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · TkA03G591860 · TK1151

Cytoplasm0.153

Rank 2 · TkA03G591860 · TK1151

Cell membrane0.019

Rank 3 · TkA03G591860 · TK1151

Mitochondrion0.014

Rank 4 · TkA03G591860 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G591860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14951DUF450312-84 aa

PF17244CDC24_OB316-106 aa

PF08646Rep_fac-A_C26-108 aa

PF27511ComFA_N41-71 aa

PF31228BRC-2_C42-104 aa

PF18439zf_UBZ45-53 aa

PF18439zf_UBZ59-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G591860	`PF14951`	DUF4503	12	84	0.044	13.0
TkA03G591860	`PF17244`	CDC24_OB3	16	106	0.0016	19.0
TkA03G591860	`PF08646`	Rep_fac-A_C	26	108	4.9e-12	46.6
TkA03G591860	`PF27511`	ComFA_N	41	71	0.021	15.9
TkA03G591860	`PF31228`	BRC-2_C	42	104	0.021	15.6
TkA03G591860	`PF18439`	zf_UBZ	45	53	0.82	10.1
TkA03G591860	`PF18439`	zf_UBZ	59	68	0.82	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card