TkA03G589530 | RubberDandelionOmics

Gene overview

TkA03G589530

Reference: TK1151 Chr: Chr03 Coordinates: 149760934-149764281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1682 bp · TkA03G589530|TK1151|cDNA

CTAAAAACGTCCAGACTCGAACTTACCCAAAACTAATTACTGAAAATACTCTCTTCACTTCTCAGTTCTCACCCCCCACGAGTGTCTGCAGTAGTTAAGTCATTTTGAACCCTTTTTCCTGTTTCCCTTCAAAATCATCTCTCATTTCCAAGACTGTTTCCCCCTCAATATGACGTCTCTCTTCCCCTTTTCTCTCTTTCTCTCTCTATCTTTGTACATTCGCTCCTAACACCTAGCTAGAAACAAATAAAACTACAGTA...

CDS

Download CDS FASTA

1077 bp · TkA03G589530|TK1151|CDS

ATGGGAATGATTTATGCGGACACTTTTGGTTCTTTATCGATCACCAATGATAATAATAGCCCTCCAAAGATCAACGATCATTTCATTTTTAGCCGCCCCCTAACTGCTTCTTCATCGTCGTCGTCACTCACAACCAATAATCAATGTTTTTCGGTTAACTTCCATGAAGATGAAGATGATGATGAGGAAGATGAAGAAGAAGAAGAACGTGTTTATTCTTTAAATAGTAACATTGATGGCCATAAATATGGAAAGGTAAG...

Protein

Download Protein FASTA

358 aa · TkA03G589530|TK1151|PROTEIN

MGMIYADTFGSLSITNDNNSPPKINDHFIFSRPLTASSSSSSLTTNNQCFSVNFHEDEDDDEEDEEEEERVYSLNSNIDGHKYGKVRACEELKTSARGHWRPAEDSKLKELVGLYGPQNWNLIAENLQGRSGKSCRLRWFNQLDPRINRRAFSEEEEERLMAAHRVYGNKWALMARLFPGRTDNAIKNHWHVIMARKYREQSNACRRRKMMMISQSQSQNQSQTFVQPPPPLPPAVTGHLPYMTGGLHQSPPFDFVSGPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G589530`
TK1151 ID	TkA03G589530
OH-1004 ID	LXL04_011462
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G589530

Location Chr03:149760934-149764281 (+)

Description Similar to MYB105: Transcription factor MYB105

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69560`	Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning.	LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis.2009 · DOI: 10.1242/dev.031971
`At1g26780`	Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning.	LATERAL ORGAN FUSION1 and LATERAL ORGAN FUSION2 function in lateral organ separation and axillary meristem formation in Arabidopsis.2009 · DOI: 10.1242/dev.031971 Characterization of constricted fruit (ctf) mutant uncovers a role for AtMYB117/LOF1 in ovule and fruit development in Arabidopsis thaliana.2011 · DOI: 10.1371/journal.pone.0018760
`At5g17800`	Acts as a cell-specific local repressor of quiescent center (QC) self-renewal by cell divisions in the primary root.	MYB56 encoding a R2R3 MYB transcription factor regulates seed size in Arabidopsis thaliana.2013 · DOI: 10.1111/jipb.12094 Regulation of plant stem cell quiescence by a brassinosteroid signaling module.2014 · DOI: 10.1016/j.devcel.2014.05.020 Identification of Arabidopsis MYB56 as a novel substrate for CRL3BPM E3 ligases.2014 · DOI: 10.1093/mp/ssu120
`At1g73410`	Transcription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers.	A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061325

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0274800`	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011462 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001935 endothelial cell proliferation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0051782 negative regulation of cell division Biological Process

GO:0071367 cellular response to brassinosteroid stimulus Biological Process

KEGG gene cross-reference

ath:AT1G17950

ath:AT1G26780

ath:AT1G69560

ath:AT5G17800

dosa:Os01g0274800

osa:4325181

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA03G589530 · TK1151

Cytoplasm0.088

Rank 2 · TkA03G589530 · TK1151

Cell membrane0.027

Rank 3 · TkA03G589530 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA03G589530 · TK1151

Plastid0.013

Rank 5 · TkA03G589530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_796-135 aa

PF00249Myb_DNA-binding97-143 aa

PF13921Myb_DNA-bind_6100-160 aa

PF20222DUF6581118-143 aa

PF15963Myb_DNA-bind_7148-219 aa

PF00249Myb_DNA-binding149-191 aa

PF13921Myb_DNA-bind_6152-196 aa

PF20222DUF6581170-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G589530	`PF15963`	Myb_DNA-bind_7	96	135	6e-05	23.5
TkA03G589530	`PF00249`	Myb_DNA-binding	97	143	1.8e-32	111.9
TkA03G589530	`PF13921`	Myb_DNA-bind_6	100	160	6.1e-23	81.5
TkA03G589530	`PF20222`	DUF6581	118	143	0.006	16.2
TkA03G589530	`PF15963`	Myb_DNA-bind_7	148	219	6e-05	23.5
TkA03G589530	`PF00249`	Myb_DNA-binding	149	191	1.8e-32	111.9
TkA03G589530	`PF13921`	Myb_DNA-bind_6	152	196	6.1e-23	81.5
TkA03G589530	`PF20222`	DUF6581	170	201	0.006	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEZ4`	Arabidopsis thaliana	sp\|Q9SEZ4\|MY105_ARATH Transcription factor MYB105	85.300%	Swiss-Prot	Low
`Q9LQX5`	Arabidopsis thaliana	sp\|Q9LQX5\|MY117_ARATH Transcription factor MYB117	86.100%	Swiss-Prot	Low
`Q6R053`	Arabidopsis thaliana	sp\|Q6R053\|MYB56_ARATH Transcription factor MYB56	79.600%	Swiss-Prot	Low
`Q9FX36`	Arabidopsis thaliana	sp\|Q9FX36\|MYB54_ARATH Transcription factor MYB54	76.600%	Swiss-Prot	Low
`Q5NBM8`	Oryza sativa subsp. japonica	sp\|Q5NBM8\|CSA_ORYSJ Transcription factor CSA	85.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card