TkA03G586610 | RubberDandelionOmics

Gene overview

TkA03G586610

Reference: TK1151 Chr: Chr03 Coordinates: 149047039-149049908 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1544 bp · TkA03G586610|TK1151|cDNA

AAATAAATAAGGGGTTCGAGATCCACCGACGATGGCAGGCCCATCTCCGCGTCGTTTTTCTGTTGAAAATCTCTATCACTCTCTCTGTATCTCCACTGAGATCTTACTCTAATTCAAACTATCCTCGATCTGCATCTCAATCTACTGATTCATAGATGCACATATACACGAATTACGAACATACGAGAGTTTGAAACTCTGAAAACAAAAGGGGATCACAATTGATTTGAGTAAAAATGGTGTGTCTTCGTGTACATGCA...

CDS

Download CDS FASTA

579 bp · TkA03G586610|TK1151|CDS

ATGGTGTGTCTTCGTGTACATGCAGCTGTTTCTCTGGTTATATTGCTTCATTTCCTTTTCAACGTTGCTGTTGATTGCAAAACGCTAAAAAGAGACGTGAAAGCCCTTAATGAAATTAAAGCATCTCTTGGATGGAGGGTAGTGTATGCATGGGTTGGAGATGATCCATGTGGAGATGGTGATTTACCAGCCTGGTCTGGCGTCACTTGCTCCACACAAGGTGATTATAGAGTAGTTACTGAACTGGAAGTATACGCAGT...

Protein

Download Protein FASTA

192 aa · TkA03G586610|TK1151|PROTEIN

MVCLRVHAAVSLVILLHFLFNVAVDCKTLKRDVKALNEIKASLGWRVVYAWVGDDPCGDGDLPAWSGVTCSTQGDYRVVTELEVYAVSIIGPFPTAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKKLTHLYLSFNSFKGEIQGSLQIFQIYNIFIFMKTASLVEFQQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G586610`
TK1151 ID	TkA03G586610
OH-1004 ID	LXL04_011415
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 54.688 / OH-1004 24.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G586610`
Location	Chr03:149047039-149049908 (+)
Description	Similar to RLP35: Receptor-like protein 35
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011415` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007165 signal transduction Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT3G11080 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.380

Rank 1 · TkA03G586610 · TK1151

Extracellular0.201

Rank 2 · TkA03G586610 · TK1151

Endoplasmic reticulum0.174

Rank 3 · TkA03G586610 · TK1151

Cytoplasm0.096

Rank 4 · TkA03G586610 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA03G586610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_230-71 aa

PF25019LRR_R13L1-DRL2193-133 aa

PF13855LRR_894-137 aa

PF23598LRR_1497-157 aa

PF00560LRR_1103-124 aa

PF13855LRR_8103-160 aa

PF12799LRR_4103-139 aa

PF13516LRR_6103-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G586610	`PF08263`	LRRNT_2	30	71	0.00019	22.4
TkA03G586610	`PF25019`	LRR_R13L1-DRL21	93	133	0.22	12.1
TkA03G586610	`PF13855`	LRR_8	94	137	4.8e-13	49.4
TkA03G586610	`PF23598`	LRR_14	97	157	2.8e-07	30.3
TkA03G586610	`PF00560`	LRR_1	103	124	4.6e-13	47.3
TkA03G586610	`PF13855`	LRR_8	103	160	4.8e-13	49.4
TkA03G586610	`PF12799`	LRR_4	103	139	1e-08	35.9
TkA03G586610	`PF13516`	LRR_6	103	115	0.00011	22.6
TkA03G586610	`PF12799`	LRR_4	125	159	1e-08	35.9
TkA03G586610	`PF00560`	LRR_1	126	148	4.6e-13	47.3
TkA03G586610	`PF13516`	LRR_6	127	140	0.00011	22.6
TkA03G586610	`PF25019`	LRR_R13L1-DRL21	140	157	0.22	12.1
TkA03G586610	`PF13516`	LRR_6	149	163	0.00011	22.6
TkA03G586610	`PF00560`	LRR_1	150	169	4.6e-13	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card