TkA03G585800 | RubberDandelionOmics

Gene overview

TkA03G585800

Reference: TK1151 Chr: Chr03 Coordinates: 148778285-148780798 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2290 bp · TkA03G585800|TK1151|cDNA

AATGATTATTCGATTAGCGAAAAATATCTCGTGAATTTATCAAAACGAAAGGCACCCTTAATTTTCAATTATTCTCGCAAAAAAATTCCCTAAATTCGCTTGCAAAGCGCCACGTGTTCATAACAGGTACCCGTAAAATCAATATCAAAGTAACAAACTTCCCATCAGAAAATCCGTTCTCCTTTTTTTGTTTCTTCTTCACGATAACGAATCAAACACACACCAGATCTAGGTTTCATACGATTTCAATCAACAATGGC...

CDS

Download CDS FASTA

921 bp · TkA03G585800|TK1151|CDS

ATGAGCATGGGTGATGATAAAGGAGATGGTTTGGAGTTCATTCAAGAAAACAAGAAAAGATATAATTTGAAGGATTTGTTGTCTTCTGATGCTGTGTTGATGGGGAAGGGCAATATAGGAAATACATACAGGGCATTCTTGAAAATTGGTGAAGTTGTGGCGGTCAAGAGATTGAAAGGGCAATTTTCGTATGGAATAAGCAAACAACATCTTCAAGCATTAGGAAAAATTTCTCATAGAAATTTATTGCCTTTTAAAGC...

Protein

Download Protein FASTA

306 aa · TkA03G585800|TK1151|PROTEIN

MSMGDDKGDGLEFIQENKKRYNLKDLLSSDAVLMGKGNIGNTYRAFLKIGEVVAVKRLKGQFSYGISKQHLQALGKISHRNLLPFKAYMFSKHEHLLVYDYMPFGSLYSHLHGGKSETSLGWESRMKVAYGVARGIEHIHKQGHGVCHGNIRSSNVFLNKSYVARLSEFVIPQLFDKVNLSSEYRAPEVKLASQQGDVYSFGVLLLELCTNKDLVKEEEGFSIAKWVRLMFQEKEIIDVFYERLRVYNNEKIGVQMVQML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G585800`
TK1151 ID	TkA03G585800
OH-1004 ID	LXL04_011382
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G585800

Location Chr03:148778285-148780798 (-)

Description Similar to RKL1: Probable inactive receptor kinase At1g48480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48480`	Probable inactive receptor kinase At1g48480.	No verified direct reference in this release
`At3g17840`	Probable inactive receptor kinase RLK902.	No verified direct reference in this release
`At4g23740`	Probable inactive receptor kinase At4g23740.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G48480

ath:AT2G26730

ath:AT3G17840

ath:AT4G23740

ath:AT5G16590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.513

Rank 1 · TkA03G585800 · TK1151

Cytoplasm0.388

Rank 2 · TkA03G585800 · TK1151

Nucleus0.271

Rank 3 · TkA03G585800 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G585800 · TK1151

Golgi apparatus0.027

Rank 5 · TkA03G585800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase33-279 aa

PF07714PK_Tyr_Ser-Thr34-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G585800	`PF00069`	Pkinase	33	279	1e-22	81.5
TkA03G585800	`PF07714`	PK_Tyr_Ser-Thr	34	283	3.4e-24	86.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LP77`	Arabidopsis thaliana	sp\|Q9LP77\|Y1848_ARATH Probable inactive receptor kinase At1g48480	41.900%	Swiss-Prot	Medium
`Q9LVI6`	Arabidopsis thaliana	sp\|Q9LVI6\|RLK90_ARATH Probable inactive receptor kinase RLK902	41.200%	Swiss-Prot	Medium
`Q9SUQ3`	Arabidopsis thaliana	sp\|Q9SUQ3\|Y4374_ARATH Probable inactive receptor kinase At4g23740	39.500%	Swiss-Prot	Medium
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	38.500%	Swiss-Prot	Medium
`Q9M9C5`	Arabidopsis thaliana	sp\|Q9M9C5\|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400	41.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card