TkA03G583610 | RubberDandelionOmics

Gene overview

TkA03G583610

Reference: TK1151 Chr: Chr03 Coordinates: 148201337-148201904 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA03G583610|TK1151|cDNA

ATGGCTCTATCCGGCAAAATAATTGGTTATGTGGAGATCAAGAAGCAGGGGAAAGTCTTCCATGATCTCTTTAGGCACAACCCACATAACATAGTTTCAGCAATCCCCGATAAGGTTCATGATTGTGAACTTCATGAAGGTGATAGGGGGGCGGTTGGATCTACTATATGTTGGCACTACACTCATGATGGAAAGAAGAAAAGTCTTAAGCAGATAATTGAATCAGTGAATGAGGAAAACCACATGACTGTGTATAAGTG...

CDS

Download CDS FASTA

453 bp · TkA03G583610|TK1151|CDS

ATGGCTCTATCCGGCAAAATAATTGGTTATGTGGAGATCAAGAAGCAGGGGAAAGTCTTCCATGATCTCTTTAGGCACAACCCACATAACATAGTTTCAGCAATCCCCGATAAGGTTCATGATTGTGAACTTCATGAAGGTGATAGGGGGGCGGTTGGATCTACTATATGTTGGCACTACACTCATGATGGAAAGAAGAAAAGTCTTAAGCAGATAATTGAATCAGTGAATGAGGAAAACCACATGACTGTGTATAAGTG...

Protein

Download Protein FASTA

150 aa · TkA03G583610|TK1151|PROTEIN

MALSGKIIGYVEIKKQGKVFHDLFRHNPHNIVSAIPDKVHDCELHEGDRGAVGSTICWHYTHDGKKKSLKQIIESVNEENHMTVYKCIEGDLMEEYKSFTIILHVEKKGDKELATWTFEFERPDLSVPYPTSLMDYLCNLVKDLDAHSST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G583610`
TK1151 ID	TkA03G583610
OH-1004 ID	LXL04_011351
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G583610

Location Chr03:148201337-148201904 (-)

Description Similar to MLP43: MLP-like protein 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70890`	MLP-like protein 43.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002253 activation of immune response Biological Process

GO:0006952 defense response Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G70840

ath:AT1G70850

ath:AT1G70890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.851

Rank 1 · TkA03G583610 · TK1151

Nucleus0.262

Rank 2 · TkA03G583610 · TK1151

Cell membrane0.054

Rank 3 · TkA03G583610 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA03G583610 · TK1151

Mitochondrion0.042

Rank 5 · TkA03G583610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00407Bet_v_13-147 aa

PF10604Polyketide_cyc238-125 aa

PF23648DUF714743-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G583610	`PF00407`	Bet_v_1	3	147	4.5e-37	128.0
TkA03G583610	`PF10604`	Polyketide_cyc2	38	125	0.0022	18.9
TkA03G583610	`PF23648`	DUF7147	43	95	0.19	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSK5`	Arabidopsis thaliana	sp\|Q9SSK5\|MLP43_ARATH MLP-like protein 43	43.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card