TkA03G581510 | RubberDandelionOmics

Gene overview

TkA03G581510

Reference: TK1151 Chr: Chr03 Coordinates: 147582417-147588666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1151 bp · TkA03G581510|TK1151|cDNA

CTAGTACGAGTCATCGTCAACAATTTACAGTCATGGTACTCCCTTATAAAACCCACCTACGATGTGCTACACCTAGAGCGATAGAAATAGAGATAAGGGTTATATTCAGATTCAGAGAAATTCTCCGTCGGAAGTTGCGTAGAAATTCGCCGATGGGGCGGAGGAAGCTCGAAATAAAGCGGATCGAAGACAAGAGTAGCAGACTGGTGACGTTTTCGAAGCGGAGAACGGGTTTGATTAAGAAAGCACGACAGCTTTCC...

CDS

Download CDS FASTA

468 bp · TkA03G581510|TK1151|CDS

ATGGTACTCCCTTATAAAACCCACCTACGATGTGCTACACCTAGAGCGATAGAAATAGAGATAAGGGTTATATTCAGATTCAGAGAAATTCTCCGTCGGAAGTTGCGTAGAAATTCGCCGATGGGGCGGAGGAAGCTCGAAATAAAGCGGATCGAAGACAAGAGTAGCAGACTGGTGACGTTTTCGAAGCGGAGAACGGGTTTGATTAAGAAAGCACGACAGCTTTCCGTGCTCTGCGACGTCGACGTCGCCGTCATTGT...

Protein

Download Protein FASTA

155 aa · TkA03G581510|TK1151|PROTEIN

MVLPYKTHLRCATPRAIEIEIRVIFRFREILRRKLRRNSPMGRRKLEIKRIEDKSSRLVTFSKRRTGLIKKARQLSVLCDVDVAVIVFSARGKLYEFCSGGTANRVEHILARYEAEGNTTINENGQDLEVPLEHVKSFYTQLTGLLKRITVRSCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581510`
TK1151 ID	TkA03G581510
OH-1004 ID	LXL04_011303
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 82.581 / OH-1004 47.232 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G581510

Location Chr03:147582417-147588666 (-)

Description Similar to AGL31: Agamous-like MADS-box protein AGL31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10140`	Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways.	No verified direct reference in this release
`At1g77080`	Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0883100`	Probable transcription factor involved in the development of floral organs.	No verified direct reference in this release
`Os09g0507200`	Probable transcription factor.	Characterization of two rice MADS box genes that control flowering time.1997 · PMID: 9339904
`Os06g0712700`	Probable transcription factor involved in the development of floral organs.	SUPERWOMAN1 and DROOPING LEAF genes control floral organ identity in rice.2003 · DOI: 10.1242/dev.00294 Alteration of floral organ identity in rice through ectopic expression of OsMADS16.2003 · DOI: 10.1007/s00425-003-1066-8 Functional analysis of the rice AP3 homologue OsMADS16 by RNA interference.2003 · DOI: 10.1023/a:1025401611354

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011303 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010048 vernalization response Biological Process

GO:0010221 negative regulation of vernalization response Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G77080

ath:AT2G45650

ath:AT5G10140

ath:AT5G65050

ath:AT5G65060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · TkA03G581510 · TK1151

Cytoplasm0.132

Rank 2 · TkA03G581510 · TK1151

Cell membrane0.023

Rank 3 · TkA03G581510 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA03G581510 · TK1151

Plastid0.014

Rank 5 · TkA03G581510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03906Phage_T7_tail23-64 aa

PF00319SRF-TF50-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581510	`PF03906`	Phage_T7_tail	23	64	0.28	11.9
TkA03G581510	`PF00319`	SRF-TF	50	97	2.7e-25	88.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Q7`	Arabidopsis thaliana	sp\|Q9S7Q7\|FLC_ARATH MADS-box protein FLOWERING LOCUS C	69.900%	Swiss-Prot	Low
`Q9AT76`	Arabidopsis thaliana	sp\|Q9AT76\|AGL27_ARATH Agamous-like MADS-box protein AGL27	66.200%	Swiss-Prot	Low
`Q40702`	Oryza sativa subsp. japonica	sp\|Q40702\|MADS2_ORYSJ MADS-box transcription factor 2	47.400%	Swiss-Prot	Medium
`Q9SAR1`	Oryza sativa subsp. japonica	sp\|Q9SAR1\|MADS8_ORYSJ MADS-box transcription factor 8	52.900%	Swiss-Prot	Medium
`Q944S9`	Oryza sativa subsp. japonica	sp\|Q944S9\|MAD16_ORYSJ MADS-box transcription factor 16	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card