TkA03G581150 | RubberDandelionOmics

Gene overview

TkA03G581150

Reference: TK1151 Chr: Chr03 Coordinates: 147483907-147485465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

674 bp · TkA03G581150|TK1151|cDNA

ATGTTGTTTAACTATGCATGTCGCAGTGTGGAGCATCTTCTTGCTAGGTATGAAGCAAATGCGAACAGGACCATAAATGGAAATGCCCAAGATTTGGAAGTCCCATTGGAGTGCACAAAATTCCGAACATGTAAAGAGCTTCTACACACAGTTGACAGGCTTGTTGAAGAGAATAACAGTGAGGAGCTGTCTGTGACTGACATGACACAACTGGAAGAAGAACTTGATGCTGCTCTTATGCAGACACGATCAAGAAAGAC...

CDS

Download CDS FASTA

462 bp · TkA03G581150|TK1151|CDS

ATGTTGTTTAACTATGCATGTCGCAGTGTGGAGCATCTTCTTGCTAGGTATGAAGCAAATGCGAACAGGACCATAAATGGAAATGCCCAAGATTTGGAAGTCCCATTGGAGTGCACAAAATTCCGAACATGTAAAGAGCTTCTACACACAGTTGACAGGCTTGTTGAAGAGAATAACAGTGAGGAGCTGTCTGTGACTGACATGACACAACTGGAAGAAGAACTTGATGCTGCTCTTATGCAGACACGATCAAGAAAGAC...

Protein

Download Protein FASTA

153 aa · TkA03G581150|TK1151|PROTEIN

MLFNYACRSVEHLLARYEANANRTINGNAQDLEVPLECTKFRTCKELLHTVDRLVEENNSEELSVTDMTQLEEELDAALMQTRSRKTQLKMEYISTLQEQERNLIKEKKEIVQEIATADQVFGAGDDEGGGRNDLSINQMDSPRHVTLPLFRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581150`
TK1151 ID	TkA03G581150
OH-1004 ID	LXL04_011297
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 94.771 / OH-1004 78.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G581150`
Location	Chr03:147483907-147485465 (-)
Description	Similar to Agamous-like MADS-box protein AGL8 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011297` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0010022 meristem determinacy Biological Process GO:0010093 specification of floral organ identity Biological Process GO:0010582 floral meristem determinacy Biological Process GO:0030154 cell differentiation Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048509 regulation of meristem development Biological Process GO:0005634 nucleus Cellular Component GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
KEGG gene cross-reference	dosa:Os03g0215400 sot:102577795 vvi:100232952 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · TkA03G581150 · TK1151

Cytoplasm0.244

Rank 2 · TkA03G581150 · TK1151

Cell membrane0.039

Rank 3 · TkA03G581150 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA03G581150 · TK1151

Mitochondrion0.016

Rank 5 · TkA03G581150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07227PHD_Oberon5-62 aa

PF01486K-box37-115 aa

PF25284DUF787444-77 aa

PF26012HH_RND_rel51-114 aa

PF07227PHD_Oberon82-119 aa

PF25284DUF787485-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581150	`PF07227`	PHD_Oberon	5	62	0.27	11.8
TkA03G581150	`PF01486`	K-box	37	115	7.4e-10	39.6
TkA03G581150	`PF25284`	DUF7874	44	77	0.18	12.6
TkA03G581150	`PF26012`	HH_RND_rel	51	114	0.017	16.1
TkA03G581150	`PF07227`	PHD_Oberon	82	119	0.27	11.8
TkA03G581150	`PF25284`	DUF7874	85	125	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card