TkA03G581020 | RubberDandelionOmics

Gene overview

TkA03G581020

Reference: TK1151 Chr: Chr03 Coordinates: 147441703-147442988 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

887 bp · TkA03G581020|TK1151|cDNA

CACAACAACATCAAAATTTACGAGTCCTGACTTTCATTTAAACATGTTCATATATTCTTCTGATGCAGAAGACTCCAACGACCAAAACGTTCCAACAACCAAATTGTTTGGTCGTGAAAAGTCTTTGCATTCCCTTCTTGGTGGAGGACAAGTTGCAAACTTGCTTTTATGGAGAAACAAAAGCTTTTCAGCCGCAATTCTACTAGGAATTACCATGATCTGGTTTCTCTTCGAAGTTGTTGAGTACACCTTTGTTTCTC...

CDS

Download CDS FASTA

657 bp · TkA03G581020|TK1151|CDS

ATGTTCATATATTCTTCTGATGCAGAAGACTCCAACGACCAAAACGTTCCAACAACCAAATTGTTTGGTCGTGAAAAGTCTTTGCATTCCCTTCTTGGTGGAGGACAAGTTGCAAACTTGCTTTTATGGAGAAACAAAAGCTTTTCAGCCGCAATTCTACTAGGAATTACCATGATCTGGTTTCTCTTCGAAGTTGTTGAGTACACCTTTGTTTCTCTTATTTGTCAAATCTCAATCCTAGTCATGTTGATTCTCTTCAT...

Protein

Download Protein FASTA

218 aa · TkA03G581020|TK1151|PROTEIN

MFIYSSDAEDSNDQNVPTTKLFGREKSLHSLLGGGQVANLLLWRNKSFSAAILLGITMIWFLFEVVEYTFVSLICQISILVMLILFITYTTAKFANWDLPDIQEITIQESAFRWLYKKTNWVLLRFYEISSGENLFEFFLVIGSLWMVSVIGNYYSSLNLLFFCCICLGTLPALYEQYQQEVDRLVRKGSKDARKVLKKLDSKVLNKIPRGRVKDKKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G581020`
TK1151 ID	TkA03G581020
OH-1004 ID	LXL04_011290
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G581020

Location Chr03:147441703-147442988 (+)

Description Similar to RTNLB9: Reticulon-like protein B9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18260`	Reticulon-like protein B9.	No verified direct reference in this release
`At1g68230`	Reticulon-like protein B14.	No verified direct reference in this release
`At2g46170`	Reticulon-like protein B5.	No verified direct reference in this release
`At3g61560`	Reticulon-like protein B6.	No verified direct reference in this release
`At4g11220`	Plays a role in the Agrobacterium-mediated plant transformation via its interaction with VirB2, the major component of the T-pilus.	Plant proteins that interact with VirB2, the Agrobacterium tumefaciens pilin protein, mediate plant transformation.2004 · DOI: 10.1105/tpc.104.026476

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011290 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0050687 negative regulation of defense response to virus Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G68230

ath:AT2G46170

ath:AT3G18260

ath:AT3G61560

ath:AT4G11220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.623

Rank 1 · TkA03G581020 · TK1151

Cell membrane0.125

Rank 2 · TkA03G581020 · TK1151

Cytoplasm0.122

Rank 3 · TkA03G581020 · TK1151

Golgi apparatus0.117

Rank 4 · TkA03G581020 · TK1151

Lysosome / Vacuole0.113

Rank 5 · TkA03G581020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02453Reticulon37-188 aa

PF10256Erf491-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G581020	`PF02453`	Reticulon	37	188	8.3e-41	140.2
TkA03G581020	`PF10256`	Erf4	91	155	0.054	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJQ5`	Arabidopsis thaliana	sp\|Q9LJQ5\|RTNLI_ARATH Reticulon-like protein B9	42.200%	Swiss-Prot	Medium
`A2RVT6`	Arabidopsis thaliana	sp\|A2RVT6\|RTNLN_ARATH Reticulon-like protein B14	44.000%	Swiss-Prot	Medium
`O82352`	Arabidopsis thaliana	sp\|O82352\|RTNLE_ARATH Reticulon-like protein B5	40.700%	Swiss-Prot	Medium
`Q6DBN4`	Arabidopsis thaliana	sp\|Q6DBN4\|RTNLF_ARATH Reticulon-like protein B6	40.300%	Swiss-Prot	Medium
`Q9SUT9`	Arabidopsis thaliana	sp\|Q9SUT9\|RTNLB_ARATH Reticulon-like protein B2	35.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card