TkA03G576150 | RubberDandelionOmics

Gene overview

TkA03G576150

Reference: TK1151 Chr: Chr03 Coordinates: 146104466-146105729 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkA03G576150|TK1151|cDNA

ATGCCGTCATTGTCTCAATCGTTAAATTCCATGAACGTTGATGATGATTTATCGTTGTTGCAGGTTGCTGATGTGAACAGAAAGATAGAAACTGATCAGGGACCAGATGTGTATCCAGCTGCACGACAGATGCTTTACCATAAAGGAAAAGAGCTAGACGATGATAGCACCACCATGGAGGTAAATGAAGTTTCTGAAAATAGTACCATCATCATCATGAAATCAAGGAGCAGGAGCTCCTCCGCCCCTCCTTCCACTCC...

CDS

Download CDS FASTA

885 bp · TkA03G576150|TK1151|CDS

ATGCCGTCATTGTCTCAATCGTTAAATTCCATGAACGTTGATGATGATTTATCGTTGTTGCAGGTTGCTGATGTGAACAGAAAGATAGAAACTGATCAGGGACCAGATGTGTATCCAGCTGCACGACAGATGCTTTACCATAAAGGAAAAGAGCTAGACGATGATAGCACCACCATGGAGGTAAATGAAGTTTCTGAAAATAGTACCATCATCATCATGAAATCAAGGAGCAGGAGCTCCTCCGCCCCTCCTTCCACTCC...

Protein

Download Protein FASTA

294 aa · TkA03G576150|TK1151|PROTEIN

MPSLSQSLNSMNVDDDLSLLQVADVNRKIETDQGPDVYPAARQMLYHKGKELDDDSTTMEVNEVSENSTIIIMKSRSRSSSAPPSTPVAAPPPSKASSSTIYCPTPSYPPKDYSQIIERSSASPPPPVAAPPRQNDSPTLYKLRLPFTVVPPPPAVPPPSPSPPNQPNTNPLDLFPQINPRVIPNFNVLRRLPVFQSIRSLVRANPTILQPVQVESRRLNAQGYILHEYEEECLRMIFEPDDGRDESRPSVPLNLAPDDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G576150`
TK1151 ID	TkA03G576150
OH-1004 ID	LXL04_011242
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G576150

Location Chr03:146104466-146105729 (-)

Description Similar to RAD23: Probable ubiquitin receptor RAD23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02540`	May be involved in nucleotide excision repair (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0407200`	May be involved in nucleotide excision repair (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0009411 response to UV Biological Process

GO:0009650 UV protection Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003684 damaged DNA binding Molecular Function

GO:0031593 polyubiquitin modification-dependent protein binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

GO:0070628 proteasome binding Molecular Function

KEGG gene cross-reference

ath:AT1G16190

ath:AT1G79650

ath:AT3G02540

dosa:Os09g0407200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.627

Rank 1 · TkA03G576150 · TK1151

Cytoplasm0.492

Rank 2 · TkA03G576150 · TK1151

Mitochondrion0.043

Rank 3 · TkA03G576150 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA03G576150 · TK1151

Cell membrane0.032

Rank 5 · TkA03G576150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin21-75 aa

PF09280XPC-binding187-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G576150	`PF00240`	ubiquitin	21	75	6.8e-06	26.5
TkA03G576150	`PF09280`	XPC-binding	187	239	1.8e-05	25.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84L31`	Arabidopsis thaliana	sp\|Q84L31\|RD23C_ARATH Ubiquitin receptor RAD23c	36.100%	Swiss-Prot	Low
`Q40742`	Oryza sativa subsp. japonica	sp\|Q40742\|RAD23_ORYSJ Probable ubiquitin receptor RAD23	40.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card