RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G575860
Reference: TK1151 Chr: Chr03 Coordinates: 146051682-146053042 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

549 bp · TkA03G575860|TK1151|cDNA

ATGATTTACTATAACGCTAAACTGCTAGAGGATGATAACACCATGGAAGTAAATGAAGTTTTTGAAAATAGTACTATATTTATCATGAAATCAAGGACGATCACGAGCTCCTCCGCTCCTCCTCCCGCTCCGGTGGCGGCACCACCCCCTGACCAGGCTTCTTCATCCACCATATCTTCTCCTACTCCATCATCTCCACCTAAAGATTACTCGCACATCATTGAGAGGTCGTCGGTTTCTCCTCCTCCTCGAGTGGCGGC...

CDS

Download CDS FASTA

549 bp · TkA03G575860|TK1151|CDS

ATGATTTACTATAACGCTAAACTGCTAGAGGATGATAACACCATGGAAGTAAATGAAGTTTTTGAAAATAGTACTATATTTATCATGAAATCAAGGACGATCACGAGCTCCTCCGCTCCTCCTCCCGCTCCGGTGGCGGCACCACCCCCTGACCAGGCTTCTTCATCCACCATATCTTCTCCTACTCCATCATCTCCACCTAAAGATTACTCGCACATCATTGAGAGGTCGTCGGTTTCTCCTCCTCCTCGAGTGGCGGC...

Protein

Download Protein FASTA

182 aa · TkA03G575860|TK1151|PROTEIN

MIYYNAKLLEDDNTMEVNEVFENSTIFIMKSRTITSSSAPPPAPVAAPPPDQASSSTISSPTPSSPPKDYSHIIERSSVSPPPRVAAPPRQYELPLSPTLYKLRLPFPGVPQPPTVPPPSPSPPNQPNTNPLDLFPQINPRLIPNSNIRRLRRLPVFQALRSDELGPPMPLNLTPDDVAAIA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G575860
TK1151 IDTkA03G575860
OH-1004 IDLXL04_011242
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)58.600
Protein coverage (%)TK1151 100.000 / OH-1004 75.170
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G575860
LocationChr03:146051682-146053042 (-)
DescriptionSimilar to RAD23: Probable ubiquitin receptor RAD23
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006289 nucleotide-excision repair Biological Process
GO:0009411 response to UV Biological Process
GO:0009650 UV protection Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0003684 damaged DNA binding Molecular Function
GO:0031593 polyubiquitin modification-dependent protein binding Molecular Function
GO:0043130 ubiquitin binding Molecular Function
GO:0070628 proteasome binding Molecular Function
KEGG gene cross-reference
ath:AT1G16190
ath:AT1G79650
ath:AT3G02540
dosa:Os09g0407200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.696
Rank 1 · TkA03G575860 · TK1151
Cytoplasm0.436
Rank 2 · TkA03G575860 · TK1151
Mitochondrion0.036
Rank 3 · TkA03G575860 · TK1151
Endoplasmic reticulum0.029
Rank 4 · TkA03G575860 · TK1151
Cell membrane0.026
Rank 5 · TkA03G575860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03377TAL_effector170-182 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G575860PF03377TAL_effector1701820.3512.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser