TkA03G575630 | RubberDandelionOmics

Gene overview

TkA03G575630

Reference: TK1151 Chr: Chr03 Coordinates: 145992030-145994297 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · TkA03G575630|TK1151|cDNA

ATGGATCCTGCCGGAAGCCCGTTTACCCGGTTGATACAAGTGTGTGTGGCGGCTTTTAGAAAGAGAAAGTTGGGTTTGGTTTCTGATTTTGATTTGCTTTATGAGAACGATGAGCTCGATGCCTCCATTTCTGTGTCGGGGAAGCTTCTTCATACTAATCAAATGAAATTTTTGGACAAGGCTGCCTTTGTCACCAAAGAAGAGTATGCAAAAGGGCATTCAAAACCGAACTTATGGCGACTAAACACAGTCCATCGATA...

CDS

Download CDS FASTA

693 bp · TkA03G575630|TK1151|CDS

ATGGATCCTGCCGGAAGCCCGTTTACCCGGTTGATACAAGTGTGTGTGGCGGCTTTTAGAAAGAGAAAGTTGGGTTTGGTTTCTGATTTTGATTTGCTTTATGAGAACGATGAGCTCGATGCCTCCATTTCTGTGTCGGGGAAGCTTCTTCATACTAATCAAATGAAATTTTTGGACAAGGCTGCCTTTGTCACCAAAGAAGAGTATGCAAAAGGGCATTCAAAACCGAACTTATGGCGACTAAACACAGTCCATCGATA...

Protein

Download Protein FASTA

230 aa · TkA03G575630|TK1151|PROTEIN

MDPAGSPFTRLIQVCVAAFRKRKLGLVSDFDLLYENDELDASISVSGKLLHTNQMKFLDKAAFVTKEEYAKGHSKPNLWRLNTVHRYLSTPFMVWRKLLCQSGIWSFFYDQAPESMRSTAIGVFWMAIAAGNYFSTLLVTMVHKLSAGDGGSNWLPDDNLNKGRLEYFYWLITSLQVLNLVYYLFCAKFYTLKPIQVARRVDEDGSNGKGDGVELGTNLDLCLNESLNPH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G575630`
TK1151 ID	TkA03G575630
OH-1004 ID	LXL04_021382
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.300
Protein coverage (%)	TK1151 95.217 / OH-1004 60.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G575630

Location Chr03:145992030-145994297 (-)

Description Similar to NPF3.1: Protein NRT1/ PTR FAMILY 3.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68570`	May act as an efflux-type nitrite transporter.	A nitrite transporter associated with nitrite uptake by higher plant chloroplasts.2007 · DOI: 10.1093/pcp/pcm073
`At3g54140`	Peptide transporter.	AtPTR1, a plasma membrane peptide transporter expressed during seed germination and in vascular tissue of Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02224.x AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At1g18880`	Low-affinity nitrate transporter facilitating nitrate loading into root phloem.	Arabidopsis nitrate transporter NRT1.9 is important in phloem nitrate transport.2011 · DOI: 10.1105/tpc.111.083618
`At5g01180`	Peptide transporter.	AtPTR1 and AtPTR5 transport dipeptides in planta.2008 · DOI: 10.1104/pp.108.123844
`At1g69870`	Low-affinity proton-dependent nitrate transporter.	The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.2009 · DOI: 10.1105/tpc.109.067603

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0015031 protein transport Biological Process

GO:0015833 peptide transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0042938 dipeptide transport Biological Process

GO:0042939 tripeptide transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G62200

ath:AT1G68570

ath:AT2G02040

ath:AT3G54140

ath:AT5G01180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.566

Rank 1 · TkA03G575630 · TK1151

Lysosome / Vacuole0.180

Rank 2 · TkA03G575630 · TK1151

Endoplasmic reticulum0.171

Rank 3 · TkA03G575630 · TK1151

Cytoplasm0.071

Rank 4 · TkA03G575630 · TK1151

Golgi apparatus0.049

Rank 5 · TkA03G575630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854PTR23-65 aa

PF00854PTR288-147 aa

PF00854PTR2177-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G575630	`PF00854`	PTR2	3	65	5.4e-07	29.6
TkA03G575630	`PF00854`	PTR2	88	147	5.4e-07	29.6
TkA03G575630	`PF00854`	PTR2	177	195	5.4e-07	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX20`	Arabidopsis thaliana	sp\|Q9SX20\|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1	41.600%	Swiss-Prot	Medium
`Q9M390`	Arabidopsis thaliana	sp\|Q9M390\|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1	26.100%	Swiss-Prot	Low
`Q9M9V7`	Arabidopsis thaliana	sp\|Q9M9V7\|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9	41.600%	Swiss-Prot	Low
`Q9LFB8`	Arabidopsis thaliana	sp\|Q9LFB8\|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2	50.600%	Swiss-Prot	Low
`Q8RX77`	Arabidopsis thaliana	sp\|Q8RX77\|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13	45.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card