TkA03G573460 | RubberDandelionOmics

Gene overview

TkA03G573460

Reference: TK1151 Chr: Chr03 Coordinates: 145395332-145397310 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1360 bp · TkA03G573460|TK1151|cDNA

TTTAACTAGAATTATTTTATCCCCTCTTTTTCCAGTCTAGTTCCAGTTCCAGTTTCAAGGAACAAGAAGCTGCAATGGCTTCCGTTACTGCTTCCTTTTCATCTTGTTTCCATGGAGAAAACTTGTCCTCTTCATGCTCATCTCTTTTCTACAGGGCTACGCTCATCTCCTCCCCGTCTATCTCTGGTAATGAATTTAACGGTAGCAATAGATTCATTGTTCTGGCAAAGAGATTGTCAGGATTGGAGGAGGCCATGAGA...

CDS

Download CDS FASTA

687 bp · TkA03G573460|TK1151|CDS

ATGGCTTCCGTTACTGCTTCCTTTTCATCTTGTTTCCATGGAGAAAACTTGTCCTCTTCATGCTCATCTCTTTTCTACAGGGCTACGCTCATCTCCTCCCCGTCTATCTCTGGTAATGAATTTAACGGTAGCAATAGATTCATTGTTCTGGCAAAGAGATTGTCAGGATTGGAGGAGGCCATGAGAATAAGAAGGGAGCGTGAGCAACAAAATTCTTCAGCAGTACCAGTTAAACGAAGAACACCTTTGAGACGTCTAAA...

Protein

Download Protein FASTA

228 aa · TkA03G573460|TK1151|PROTEIN

MASVTASFSSCFHGENLSSSCSSLFYRATLISSPSISGNEFNGSNRFIVLAKRLSGLEEAMRIRREREQQNSSAVPVKRRTPLRRLKVSPRLPVPDHIQKPPYVSSKLLPEISSEFQIHDEEGIARMRAACELAARVLEHAGTLVRPSVTTNEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECMCHGIPDSRQLQDGDIINIDVTVYLNGYHGDTSKTFLWKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G573460`
TK1151 ID	TkA03G573460
OH-1004 ID	LXL04_011212
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.246 / OH-1004 62.050 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G573460

Location Chr03:145395332-145397310 (+)

Description Similar to MAP1B: Methionine aminopeptidase 1B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13270`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release
`At3g25740`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release
`At4g37040`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011212 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0031365 N-terminal protein amino acid modification Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004177 aminopeptidase activity Molecular Function

GO:0004239 initiator methionyl aminopeptidase activity Molecular Function

GO:0008235 metalloexopeptidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G13270

ath:AT3G25740

ath:AT4G37040

ddi:DDB_G0280127

hsa:254042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA03G573460 · TK1151

Mitochondrion0.042

Rank 2 · TkA03G573460 · TK1151

Nucleus0.022

Rank 3 · TkA03G573460 · TK1151

Cytoplasm0.017

Rank 4 · TkA03G573460 · TK1151

Cell membrane0.012

Rank 5 · TkA03G573460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00557Peptidase_M24126-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G573460	`PF00557`	Peptidase_M24	126	225	2e-24	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FV52`	Arabidopsis thaliana	sp\|Q9FV52\|MAP1B_ARATH Methionine aminopeptidase 1B, chloroplastic	71.400%	Swiss-Prot	High
`Q9FV51`	Arabidopsis thaliana	sp\|Q9FV51\|MAP1C_ARATH Methionine aminopeptidase 1C, chloroplastic/mitochondrial	70.300%	Swiss-Prot	High
`Q9FV50`	Arabidopsis thaliana	sp\|Q9FV50\|MAP1D_ARATH Methionine aminopeptidase 1D, chloroplastic/mitochondrial	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card