TkA03G571960 | RubberDandelionOmics

Gene overview

TkA03G571960

Reference: TK1151 Chr: Chr03 Coordinates: 145049731-145050048 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA03G571960|TK1151|cDNA

ATGGATACTTCGAGTTCTTTACAATGGAGAGGAAGTGATTTTTGCAAATGGGAAGGAGTTCGAGAATGCTTAAGAGGTAGTGTTTCGAAACTTGTTCTTGAAAATCTGAACTTAACCGGCACACTGGATTCAAGAATCGTCAACCAATTTGATCAAATTCGTGTTTTGAGCTTGAAGCAAAACTCAATCTCTGGTCAAATTCCTGACCTTTCCGGCGAGTTTCCGACGTCTCTCACCACCCTTCACCGTCTCAAAATCAT...

CDS

Download CDS FASTA

318 bp · TkA03G571960|TK1151|CDS

ATGGATACTTCGAGTTCTTTACAATGGAGAGGAAGTGATTTTTGCAAATGGGAAGGAGTTCGAGAATGCTTAAGAGGTAGTGTTTCGAAACTTGTTCTTGAAAATCTGAACTTAACCGGCACACTGGATTCAAGAATCGTCAACCAATTTGATCAAATTCGTGTTTTGAGCTTGAAGCAAAACTCAATCTCTGGTCAAATTCCTGACCTTTCCGGCGAGTTTCCGACGTCTCTCACCACCCTTCACCGTCTCAAAATCAT...

Protein

Download Protein FASTA

105 aa · TkA03G571960|TK1151|PROTEIN

MDTSSSLQWRGSDFCKWEGVRECLRGSVSKLVLENLNLTGTLDSRIVNQFDQIRVLSLKQNSISGQIPDLSGEFPTSLTTLHRLKIIVLSSNRLSGAIPDSLLDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G571960`
TK1151 ID	TkA03G571960
OH-1004 ID	LXL04_011197
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G571960

Location Chr03:145049731-145050048 (-)

Description Similar to At1g60630: Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60630`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630.	No verified direct reference in this release
`At5g67200`	Probable inactive receptor kinase At5g67200.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011197 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033612 receptor serine/threonine kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60630

ath:AT1G68400

ath:AT2G26730

ath:AT5G67200

dosa:Os06g0203800

osa:4340427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.337

Rank 1 · TkA03G571960 · TK1151

Extracellular0.185

Rank 2 · TkA03G571960 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA03G571960 · TK1151

Cytoplasm0.103

Rank 4 · TkA03G571960 · TK1151

Nucleus0.092

Rank 5 · TkA03G571960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_25-20 aa

PF13855LRR_828-65 aa

PF00560LRR_130-44 aa

PF12799LRR_430-71 aa

PF00560LRR_153-70 aa

PF12799LRR_453-95 aa

PF13855LRR_875-105 aa

PF00560LRR_184-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G571960	`PF08263`	LRRNT_2	5	20	0.087	13.8
TkA03G571960	`PF13855`	LRR_8	28	65	0.00068	20.1
TkA03G571960	`PF00560`	LRR_1	30	44	7.1e-06	25.9
TkA03G571960	`PF12799`	LRR_4	30	71	0.018	16.0
TkA03G571960	`PF00560`	LRR_1	53	70	7.1e-06	25.9
TkA03G571960	`PF12799`	LRR_4	53	95	0.018	16.0
TkA03G571960	`PF13855`	LRR_8	75	105	0.00068	20.1
TkA03G571960	`PF00560`	LRR_1	84	104	7.1e-06	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MA9`	Arabidopsis thaliana	sp\|Q84MA9\|Y1063_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	54.100%	Swiss-Prot	High
`Q93Y06`	Arabidopsis thaliana	sp\|Q93Y06\|Y5720_ARATH Probable inactive receptor kinase At5g67200	41.100%	Swiss-Prot	Medium
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card