TkA03G570170 | RubberDandelionOmics

Gene overview

TkA03G570170

Reference: TK1151 Chr: Chr03 Coordinates: 144655111-144657807 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA03G570170|TK1151|cDNA

ATGTCATCTTATCTTGTATCGATAGCTACTTACTTGATTTGGGCATTGGATTTCATGACTCATCTTGCTTTCTTTCAGCAAAGGGTTGCCGGAAAGAATCATGATCAGCTCGGCGTCACACATTTTCATCAGAAGATGAGCTCCGATGAGTCTGTGGAATGTGCTGTGTGCTTGTCCAAGATAGACGAAGATGACGAGATAAGATTGTTGAGATGCGATCATCTTTTTCACAAAGGTTGTTTAGATCGTTGTGTCGAATA...

CDS

Download CDS FASTA

360 bp · TkA03G570170|TK1151|CDS

ATGTCATCTTATCTTGTATCGATAGCTACTTACTTGATTTGGGCATTGGATTTCATGACTCATCTTGCTTTCTTTCAGCAAAGGGTTGCCGGAAAGAATCATGATCAGCTCGGCGTCACACATTTTCATCAGAAGATGAGCTCCGATGAGTCTGTGGAATGTGCTGTGTGCTTGTCCAAGATAGACGAAGATGACGAGATAAGATTGTTGAGATGCGATCATCTTTTTCACAAAGGTTGTTTAGATCGTTGTGTCGAATA...

Protein

Download Protein FASTA

119 aa · TkA03G570170|TK1151|PROTEIN

MSSYLVSIATYLIWALDFMTHLAFFQQRVAGKNHDQLGVTHFHQKMSSDESVECAVCLSKIDEDDEIRLLRCDHLFHKGCLDRCVEYKHTTCPLCRDILAGHGWSVSLVGNYSFSLLLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G570170`
TK1151 ID	TkA03G570170
OH-1004 ID	LXL04_011171
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 84.874 / OH-1004 72.917 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G570170`
Location	Chr03:144655111-144657807 (+)
Description	Similar to XERICO: Probable E3 ubiquitin-protein ligase XERICO
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011171` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0009651 response to salt stress Biological Process GO:0009687 abscisic acid metabolic process Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009739 response to gibberellin Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010200 response to chitin Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042742 defense response to bacterium Biological Process
KEGG gene cross-reference	ath:AT2G01150 ath:AT2G04240 ath:AT3G05200 ath:AT3G61460 ath:AT4G28890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.303

Rank 1 · TkA03G570170 · TK1151

Endoplasmic reticulum0.297

Rank 2 · TkA03G570170 · TK1151

Nucleus0.269

Rank 3 · TkA03G570170 · TK1151

Golgi apparatus0.164

Rank 4 · TkA03G570170 · TK1151

Cell membrane0.143

Rank 5 · TkA03G570170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23413zf_RING_Vps8_fungal46-57 aa

PF20076DUF647249-72 aa

PF14447Prok-RING_449-66 aa

PF14446Prok-RING_149-89 aa

PF13920zf-C3HC4_351-97 aa

PF05883Baculo_RING51-97 aa

PF13639zf-RING_253-96 aa

PF17123zf-RING_1153-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G570170	`PF23413`	zf_RING_Vps8_fungal	46	57	0.94	9.5
TkA03G570170	`PF20076`	DUF6472	49	72	0.067	14.1
TkA03G570170	`PF14447`	Prok-RING_4	49	66	0.11	13.1
TkA03G570170	`PF14446`	Prok-RING_1	49	89	0.93	10.4
TkA03G570170	`PF13920`	zf-C3HC4_3	51	97	9.4e-05	22.9
TkA03G570170	`PF05883`	Baculo_RING	51	97	0.79	10.4
TkA03G570170	`PF13639`	zf-RING_2	53	96	8.3e-12	45.9
TkA03G570170	`PF17123`	zf-RING_11	53	81	7e-10	39.1
TkA03G570170	`PF14634`	zf-RING_5	53	96	1.5e-07	32.0
TkA03G570170	`PF12678`	zf-rbx1	53	96	4.1e-05	24.4
TkA03G570170	`PF13923`	zf-C3HC4_2	53	95	0.00019	21.9
TkA03G570170	`PF25998`	U-box_ZFPL1	53	87	0.43	11.7
TkA03G570170	`PF00097`	zf-C3HC4	54	95	3.6e-07	30.6
TkA03G570170	`PF13445`	zf-RING_UBOX	54	93	0.00018	22.2
TkA03G570170	`PF23412`	zf_RING_Vps8	54	83	0.0058	17.2
TkA03G570170	`PF14570`	zf-RING_4	54	97	0.05	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card