RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G566830
Reference: TK1151 Chr: Chr03 Coordinates: 143820270-143831576 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3848 bp · TkA03G566830|TK1151|cDNA

CTTCCTCTTCTCATACAGTTCTGAAGAACCTAAATTATCCGATTAATGGAACGGAGGGACTACAATCGCGATGGCTACAGCCGTGGCCGTGGCCGTGTCGATCGGTACTATGTAGACGCACGGGATGGTGATAGAGGCGGATATGGCGACGACCGGCACTATGGGGGCGGCGCACAAGACAGTGAAAGAGGCGGATATGGCGGCGACCGGTACTATGGGGGCGGCGCACAAGACAGTGAAAGGGGTGGATATGGCGGCGA...

CDS

Download CDS FASTA

3498 bp · TkA03G566830|TK1151|CDS

ATGGAACGGAGGGACTACAATCGCGATGGCTACAGCCGTGGCCGTGGCCGTGTCGATCGGTACTATGTAGACGCACGGGATGGTGATAGAGGCGGATATGGCGACGACCGGCACTATGGGGGCGGCGCACAAGACAGTGAAAGAGGCGGATATGGCGGCGACCGGTACTATGGGGGCGGCGCACAAGACAGTGAAAGGGGTGGATATGGCGGCGACCGGTACTTTGGGGGTTCACAAGACGTTGAAAGGGGCGGATATGG...

Protein

Download Protein FASTA

1165 aa · TkA03G566830|TK1151|PROTEIN

MERRDYNRDGYSRGRGRVDRYYVDARDGDRGGYGDDRHYGGGAQDSERGGYGGDRYYGGGAQDSERGGYGGDRYFGGSQDVERGGYGGDRYSGGAQIGERGGYGGDRYSGGAQIGERGGYGGDRYYDGRAGYVGDRYYEEAQDDGRGGFSGETGAGYHPRGGGRDRNYPHPYNDRHQEQYGGSRRGDGGGRSYGTGQGGGRGGDGGGYYPRGGGRGRSYPQQHNNQHQDQYGGGRGRVSSGGGGGQLATRTPAPTNPWQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G566830
TK1151 IDTkA03G566830
OH-1004 IDLXL04_011122
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)99.600
Protein coverage (%)TK1151 82.232 / OH-1004 54.063
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G566830
LocationChr03:143820270-143831576 (-)
DescriptionSimilar to AGO2: Protein argonaute 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g31280 Involved in RNA-mediated post-transcriptional gene silencing (PTGS).
Sorting of small RNAs into Arabidopsis argonaute complexes is directed by the 5' terminal nucleotide.2008 · DOI: 10.1016/j.cell.2008.02.034
The mechanism selecting the guide strand from small RNA duplexes is different among argonaute proteins.2008 · DOI: 10.1093/pcp/pcn043
NERD, a plant-specific GW protein, defines an additional RNAi-dependent chromatin-based pathway in Arabidopsis.2012 · DOI: 10.1016/j.molcel.2012.07.027
RH3 enhances antiviral defense by facilitating small RNA loading into Argonaute 2 at endoplasmic reticulum-chloroplast membrane contact sites.2025 · DOI: 10.1038/s41467-025-57296-6
At1g31290 Involved in RNA-mediated post-transcriptional gene silencing (PTGS). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0615700 Probably involved in the RNA silencing pathway. No verified direct reference in this release
Os04g0615800 Probably involved in the RNA silencing pathway. No verified direct reference in this release
Os03g0449200 Involved in the RNA silencing pathway.
Over-expression of rice OsAGO7 gene induces upward curling of the leaf blade that enhanced erect-leaf habit.2007 · DOI: 10.1007/s00425-006-0472-0
The small interfering RNA production pathway is required for shoot meristem initiation in rice.2007 · DOI: 10.1073/pnas.0704339104
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006417 regulation of translation Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0051607 defense response to virus Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:1990904 ribonucleoprotein complex Cellular Component
KEGG gene cross-reference
ath:AT1G31280
ath:AT1G31290
dosa:Os04g0615700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.704
Rank 1 · TkA03G566830 · TK1151
Nucleus0.349
Rank 2 · TkA03G566830 · TK1151
Mitochondrion0.077
Rank 3 · TkA03G566830 · TK1151
Cell membrane0.066
Rank 4 · TkA03G566830 · TK1151
Endoplasmic reticulum0.060
Rank 5 · TkA03G566830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08699ArgoL1214-233 aa
PF16486ArgoN337-469 aa
PF08699ArgoL1480-529 aa
PF16487ArgoMid548-578 aa
PF02170PAZ549-658 aa
PF16488ArgoL2676-723 aa
PF16487ArgoMid696-716 aa
PF16487ArgoMid742-819 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G566830PF08699ArgoL12142334.8e-0936.4
TkA03G566830PF16486ArgoN3374693.1e-2383.5
TkA03G566830PF08699ArgoL14805294.8e-0936.4
TkA03G566830PF16487ArgoMid5485780.0001123.1
TkA03G566830PF02170PAZ5496582.4e-2279.9
TkA03G566830PF16488ArgoL26767235.3e-0936.9
TkA03G566830PF16487ArgoMid6967160.0001123.1
TkA03G566830PF16487ArgoMid7428190.0001123.1
TkA03G566830PF02171Piwi83511275.3e-92309.0
TkA03G566830PF16488ArgoL28618885.3e-0936.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SHF3Arabidopsis thalianasp|Q9SHF3|AGO2_ARATH Protein argonaute 246.100%Swiss-ProtMedium
Q9SHF2Arabidopsis thalianasp|Q9SHF2|AGO3_ARATH Protein argonaute 346.000%Swiss-ProtMedium
Q7XTS4Oryza sativa subsp. japonicasp|Q7XTS4|AGO2_ORYSJ Protein argonaute 242.000%Swiss-ProtMedium
Q7XTS3Oryza sativa subsp. japonicasp|Q7XTS3|AGO3_ORYSJ Protein argonaute 340.900%Swiss-ProtMedium
Q75HC2Oryza sativa subsp. japonicasp|Q75HC2|AGO7_ORYSJ Protein argonaute 737.400%Swiss-ProtMedium

JBrowse

View in Genome Browser