TkA03G565840 | RubberDandelionOmics

Gene overview

TkA03G565840

Reference: TK1151 Chr: Chr03 Coordinates: 143562251-143563548 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

841 bp · TkA03G565840|TK1151|cDNA

AAATAGCTGGGCTCGCGCCGATCTTATCATTTCCGTTTTGGGGGAAAACCGACTCGGCGCACGGTCTCTTCCCAAAGACATGCCTTCACTCGATAGTCGATACCGCTAGTGACCTTATTTTATGGACGCAGTAACGTTCGGCATCATCGTCGGGATAATAATCCTCTTCTTTGTCATTGTTTGCTTCATCACCATCGAAGGCACCTGCAAACGCCGGTCTTCTTGATTTCCCATGTCCCCATCCTAACGCTCTTTAAATC...

CDS

Download CDS FASTA

516 bp · TkA03G565840|TK1151|CDS

ATGGTGATTCATCAATCTGAGAGTCGGATCTACAGCATGATTTTAATATTGGTTTTGACGATTGGGTTTAATTTTGAAGCGGGTTTCGGGCAAGAGTGCCCGCACTCTAGTGAGCCGGCGGTTCCTGAATCTCATGACCACCTTCATAACTGCGACCACGCGCATGACCATCATCATCACTCGCATGATCAGCGCCGTCTCGATTTGGGGAGGAAAAAGCTTCCGGAGGAACTGGCGGAAGAGGATGATCTTAGGTTTGA...

Protein

Download Protein FASTA

172 aa · TkA03G565840|TK1151|PROTEIN

MVIHQSESRIYSMILILVLTIGFNFEAGFGQECPHSSEPAVPESHDHLHNCDHAHDHHHHSHDQRRLDLGRKKLPEELAEEDDLRFEYVSHNDHDHDHYHGGDSELSGVALWIHAMGCSLLVSLASLISLILLPLMFFKGKPSKTFVDSLAVFGAGAMLGDAFLHQLPHAFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G565840`
TK1151 ID	TkA03G565840
OH-1004 ID	LXL04_011110
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 38.739 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G565840

Location Chr03:143562251-143563548 (+)

Description Similar to IAR1: IAA-alanine resistance protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68100`	May participate in auxin metabolism or response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0048515 spermatid differentiation Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0090727 positive regulation of brood size Biological Process

GO:0110075 regulation of ferroptosis Biological Process

GO:1905516 positive regulation of fertilization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G68100

cel:CELE_T28F3.3

dre:30094

hsa:7922

mmu:14977

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.493

Rank 1 · TkA03G565840 · TK1151

Golgi apparatus0.258

Rank 2 · TkA03G565840 · TK1151

Lysosome / Vacuole0.135

Rank 3 · TkA03G565840 · TK1151

Cytoplasm0.105

Rank 4 · TkA03G565840 · TK1151

Nucleus0.086

Rank 5 · TkA03G565840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535Zip8-23 aa

PF02535Zip42-64 aa

PF18133HydF_tetramer61-120 aa

PF02535Zip110-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G565840	`PF02535`	Zip	8	23	3.6e-09	37.0
TkA03G565840	`PF02535`	Zip	42	64	3.6e-09	37.0
TkA03G565840	`PF18133`	HydF_tetramer	61	120	0.012	16.1
TkA03G565840	`PF02535`	Zip	110	171	3.6e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M647`	Arabidopsis thaliana	sp\|Q9M647\|IAR1_ARATH IAA-alanine resistance protein 1	55.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card