TkA03G564950 | RubberDandelionOmics

Gene overview

TkA03G564950

Reference: TK1151 Chr: Chr03 Coordinates: 143359119-143361806 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1853 bp · TkA03G564950|TK1151|cDNA

GATTATACTCCTTCAACATGGGACCTGTCCGGTAGTCAATTTTCTGAGCGATCATTTGGCGATACAACTCCGTCACCAACGTTCCAGTTGTTCCTCCTGTACCGTCAAAAATTCTGCCAATCTGAGTTTTCCGCAAAAGTCACTTCAACAGGCATTAACAACGAACCTCCTAACATAACTATTAAATTGTTGAGACCTGAAGACGAAGAACATGAAGAAAGCTACCAGATGATGAGGAAAAGGGAGAGAAAGCAGGTATA...

CDS

Download CDS FASTA

909 bp · TkA03G564950|TK1151|CDS

GATTATACTCCTTCAACATGGGACCTGTCCGGTAGTCAATTTTCTGAGCGATCATTTGGCGATACAACTCCGTCACCAACGTTCCAGTTGTTCCTCCTGTACCGTCAAAAATTCTGCCAATCTGAGTTTTCCGCAAAAGTCACTTCAACAGGCATTAACAACGAACCTCCTAACATAACTATTAAATTGTTGAGACCTGAAGACGAAGAACATGAAGAAAGCTACCAGATGATGAGGAAAAGGGAGAGAAAGCAGGTATA...

Protein

Download Protein FASTA

302 aa · TkA03G564950|TK1151|PROTEIN

DYTPSTWDLSGSQFSERSFGDTTPSPTFQLFLLYRQKFCQSEFSAKVTSTGINNEPPNITIKLLRPEDEEHEESYQMMRKRERKQVYLHNYAEEYYGTKEYGQMVVHQRLQMVHWIIEQSANKELQKETMFLAVSFLDRFLSKGCFTNEKELQIVGIACLTLATRIEENQPSNSIRQQSFNIGSNGYSRSEVVAMEWLVQEVLSFQCFLPTIYNFLWYYLKAARANQDIDKTAKYLAVLTLLGHEQLCFWPSTVAASLVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G564950`
TK1151 ID	TkA03G564950
OH-1004 ID	LXL04_011080
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 50.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G564950

Location Chr03:143359119-143361806 (+)

Description Similar to SDS: Cyclin-SDS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14750`	Meiosis-specific cyclin.	No verified direct reference in this release
`At5g06150`	May induce mitotic cell division.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0225200`	Meiosis-specific cyclin.	No verified direct reference in this release
`Os03g0607600`	Cyclin-A3-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011080 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0044772 mitotic cell cycle phase transition Biological Process

GO:0045143 homologous chromosome segregation Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G14750

dosa:Os03g0225200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.725

Rank 1 · TkA03G564950 · TK1151

Cytoplasm0.339

Rank 2 · TkA03G564950 · TK1151

Mitochondrion0.038

Rank 3 · TkA03G564950 · TK1151

Cell membrane0.035

Rank 4 · TkA03G564950 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA03G564950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134Cyclin_N74-206 aa

PF02984Cyclin_C133-143 aa

PF10432bact-PGI_C209-275 aa

PF02984Cyclin_C210-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G564950	`PF00134`	Cyclin_N	74	206	1.4e-21	77.3
TkA03G564950	`PF02984`	Cyclin_C	133	143	2e-12	47.9
TkA03G564950	`PF10432`	bact-PGI_C	209	275	0.058	14.1
TkA03G564950	`PF02984`	Cyclin_C	210	297	2e-12	47.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFW3`	Arabidopsis thaliana	sp\|Q1PFW3\|CCSDS_ARATH Cyclin-SDS	47.300%	Swiss-Prot	Medium
`Q39067`	Arabidopsis thaliana	sp\|Q39067\|CCB12_ARATH Cyclin-B1-2	30.100%	Swiss-Prot	Medium
`Q10PQ9`	Oryza sativa subsp. japonica	sp\|Q10PQ9\|CCSDS_ORYSJ Cyclin-SDS-like	48.800%	Swiss-Prot	Medium
`Q75I54`	Oryza sativa subsp. japonica	sp\|Q75I54\|CCA31_ORYSJ Cyclin-A3-1	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card